KEGG   Avibacterium paragallinarum: EIA51_02570Help
Entry
EIA51_02570       CDS       T05728                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
apag  Avibacterium paragallinarum
Pathway
apag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apag01100  Metabolic pathways
apag01110  Biosynthesis of secondary metabolites
apag01130  Biosynthesis of antibiotics
apag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EIA51_02570 (aroK)
Enzymes [BR:apag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     EIA51_02570 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 Cytidylate_kin dNK AAA TsaE ABC_tran AAA_16 Mg_chelatase AAA_5 AAA_24 CoaE AAA_22 AAA_23 AAA_PrkA AAA_17 Rad17 IstB_IS21 AAA_29 Ploopntkinase3 AAA_28 APS_kinase AAA_7 DUF1727 AAA_25
Motif
Other DBs
NCBI-ProteinID: AZI13620
UniProt: A0A0F5F0Q8
LinkDB All DBs
Position
481937..482464
Genome map
AA seq 175 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQLLGMDFIDTDAEIEQRAGADISWIFDVEGEEGFR
KREERIINELTQKQGIVLSTGGGAVMSKENRNHLSARGIVIYLETTVDKQFERTQRDKKR
PLLQDVEDPRQVLEELSKIRNPLYQEVADITLPTDDQSAKVMANQIVDLIENING
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacgtaatattttcttagttggtccaatgggagctgggaaaagcacaatt
ggtcgtcagttagcacaattattgggaatggattttattgataccgatgctgaaattgaa
cagcgtgcgggggcggatattagctggatctttgatgtggagggagaagaaggcttccgt
aaacgtgaagagcgtattattaatgaattaacgcagaaacagggtatcgtgctttccact
ggcggtggtgcggtgatgtcgaaagaaaaccgtaatcatctttctgctcgcggtattgtg
atttaccttgaaaccacggtagataagcagtttgaacggacacagcgagataaaaaacgc
ccgttattgcaagatgtggaagatccgcgtcaagtgcttgaagaattgtcgaaaatccgc
aatccactttatcaagaagtggcagatattaccttgccaaccgatgatcaaagtgcgaag
gtaatggcaaatcaaattgttgatttaattgagaatatcaacggttaa

DBGET integrated database retrieval system