KEGG   Avibacterium paragallinarum: EIA51_09145
Entry
EIA51_09145       CDS       T05728                                 

Definition
(GenBank) S-ribosylhomocysteine lyase
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
apag  Avibacterium paragallinarum
Pathway
apag00270  Cysteine and methionine metabolism
apag01100  Metabolic pathways
apag01230  Biosynthesis of amino acids
apag02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:apag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EIA51_09145
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EIA51_09145
Enzymes [BR:apag01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     EIA51_09145
SSDB
Motif
Pfam: LuxS
Other DBs
NCBI-ProteinID: AZI14754
UniProt: A0A0F5EQV1
LinkDB
Position
complement(1935092..1935598)
AA seq 168 aa
MPLLDSFKVDHTKMNAPAVRVAKIMRTPKGDDITIFDLRFCIPNKEILPPKGIHTLEHLF
AGFMRDHLNSEQVEIIDISPMGCRTGFYMSLIGRPNEQQVVTAWLAAMKDILQVQNQNDI
PELNEYQCGTYTEHSLDEAHQIARNILARGVGVNRNDDLLLDERLLAQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgccgttacttgatagttttaaagtcgatcatacgaagatgaatgctcccgccgtgcgt
gttgcaaaaataatgcgtacaccaaaaggtgatgacattaccattttcgatttacgtttt
tgtattccaaataaagaaattttaccgccgaaagggattcatactcttgaacatcttttt
gcaggttttatgcgggatcacttgaatagtgagcaagttgagattattgacatttctcca
atggggtgccgtacagggttttatatgtcattaattggtagaccgaatgagcaacaagtc
gtaacagcttggcttgcggcaatgaaagatattctacaagtgcaaaatcaaaatgatatt
cctgaattaaatgaataccaatgtggcacttatacagagcattccttagatgaagctcat
cagattgcacgcaatattcttgctcgtggtgttggtgtgaatagaaatgacgatttattg
ttagatgagcgtttgcttgcacaataa

DBGET integrated database retrieval system