KEGG   Aeribacillus pallidus: AP3564_03235
Entry
AP3564_03235      CDS       T04993                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
apak  Aeribacillus pallidus
Pathway
apak00471  D-Glutamine and D-glutamate metabolism
apak00550  Peptidoglycan biosynthesis
apak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AP3564_03235
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AP3564_03235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apak01011]
    AP3564_03235
Enzymes [BR:apak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     AP3564_03235
Peptidoglycan biosynthesis and degradation proteins [BR:apak01011]
 Precursor biosynthesis
  Amino acid ligase
   AP3564_03235
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: ASS89402
UniProt: A0A165YHC1
LinkDB
Position
675919..677217
AA seq 432 aa
MTAYHFVGIKGTGMSALAQILHDMNENVQGSDIEKYIFTQKGLEERGIQIFPFSKNNIHP
GLTVIAGNAFPDTHEEIEEAKRLQLPVYRYHKFLGELMNKFTSIAVTGVHGKTSTTGLLS
HVMQGAFPTSYLIGDGTGKGVQNSKYFVFEACEYRRHFLSYHPDYAIMTNIDFDHPDYYR
DLDDVFSAFQQMALQVKKGIIACGDDERLQEIQAKVPVLYYGFHEENDFQARNVVKSTTG
TVFDVYIRNTFYGTFEIPAFGDHNVLNALAVITLCQYENIGIDVIQERVKTFKGVKRRFS
AKNFGGQVLIDDYAHHPTEIKATIEAARQKYPDREIVAVFQPHTFSRTQSFLNEFADSLK
SADKVYLCEIFGSARENIGNLTIKDLQAQIEHSELIDETNIKVLKKHESSVILFMGAGDI
QKYQDAYEKLCV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgactgcttatcattttgttggcataaaaggaacagggatgagtgctttagctcaaatc
cttcatgatatgaatgaaaatgtacaaggatctgatattgaaaaatatatttttacacaa
aaaggcttggaggaacggggaattcaaatatttcctttttcgaaaaataacattcaccct
ggtttaactgtaatagctggtaatgcttttccagatacacacgaggagattgaagaagca
aagagacttcaattgccggtttaccgctatcacaaatttttaggggaattgatgaacaaa
ttcacaagcatagcggtaactggcgtgcacggtaaaacatctacaaccggtttgctgtct
catgttatgcaaggtgcttttcctacctcatacttgattggagacggaacgggaaaagga
gttcaaaacagcaaatattttgtctttgaagcatgtgaataccggcgccattttctatcc
tatcatccggattatgcgattatgacgaacattgattttgaccaccctgattattatcgt
gatctggatgatgttttttcagcctttcagcaaatggctttacaagtgaaaaaaggaatt
atcgcttgcggagatgatgagcgtttacaggaaatacaagcgaaagttccggtattatat
tacggttttcatgaggaaaacgattttcaagcgagaaatgtggtgaaaagcacaacggga
actgtatttgatgtatatattcggaatacgttttacggcacgtttgaaattcctgcattc
ggggatcacaacgttctaaatgcgctggcggttattacgttatgccaatacgaaaatatt
ggaattgatgttattcaggagcgcgtcaaaacgtttaaaggcgtaaaaagaagattcagc
gccaaaaatttcggaggacaagtgctgattgacgattacgcccatcatcctacggaaata
aaagcaacaattgaagctgcgcggcaaaaatatcctgaccgggaaattgttgctgttttt
cagcctcataccttttcaagaacacagtcatttcttaatgagtttgcggatagtttaaaa
agcgccgacaaagtatacttatgcgaaatttttggctctgcccgtgaaaacatagggaac
ctcacgattaaagatttgcaggcgcaaattgaacattcagagttaatcgatgagacgaac
attaaagttttgaaaaagcatgaaagcagcgttattttattcatgggtgcaggagatatt
caaaaatatcaagatgcctatgaaaagctgtgtgtttaa

DBGET integrated database retrieval system