KEGG   Aeribacillus pallidus: AP3564_06755Help
Entry
AP3564_06755      CDS       T04993                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
apak  Aeribacillus pallidus
Pathway
apak00473  D-Alanine metabolism
apak00550  Peptidoglycan biosynthesis
apak01100  Metabolic pathways
apak01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AP3564_06755
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AP3564_06755
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AP3564_06755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apak01011]
    AP3564_06755
Enzymes [BR:apak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AP3564_06755
Peptidoglycan biosynthesis and degradation proteins [BR:apak01011]
 Precursor biosynthesis
  Amino acid ligase
   AP3564_06755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: ASS89984
UniProt: A0A223E400
LinkDB All DBs
Position
1388556..1389653
Genome map
AA seq 365 aa AA seqDB search
MAIKLALVYGGKSAEHQVSLQTARAVINALDKNKFDIYPIYITEQGQWVKGKQLSGPVER
VEDLKFLAGNSEAGEKGEHLPVPFSQELFNAPGSADPVHIVFPLLHGPNGEDGTIQGMLE
LLNIPYVGNGVLASAAGMDKIIMKNLFAQAGLAQAKYVWFTNKDWEKDKEEVFQKVEEQL
GYPCFVKPANLGSSVGISKAKDRQSLIQSIEEAFLYDRKLIIEESIDGREVEIGVIGNDE
PICSVVGEIAPKKEFYDYKAKYEDGDTELIIPADITEEQYEQIKKMALKAFKAIDGSGLV
RADFFLRKDGTPLINEVNTMPGFTPFSMFPLLWKHSGIDYPALIEKLVQLGIERYELKQR
IKYTI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaactggcgcttgtatatgggggcaaatctgccgagcatcaagtatcatta
caaacagctcgggcagtaataaacgctctcgataaaaataaatttgacatatatccaatt
tatattacggagcaagggcaatgggtaaaaggaaagcaattgagcggtccagttgaaaga
gtagaagacttgaagtttctagcgggaaattccgaagctggagaaaaaggtgaacatttg
ccggtacctttcagtcaagagctatttaacgctccaggaagcgctgatccagtccatatc
gtatttccgctattgcatggaccgaatggtgaagatggaacgatacaaggaatgctggaa
ttgctgaatataccttatgttgggaatggagttttggcttcagcagcaggaatggataaa
atcattatgaaaaatttatttgcccaagcaggacttgctcaggcaaagtacgtttggttt
acgaacaaagactgggaaaaagataaagaggaggtttttcaaaaagtcgaggagcagctc
ggatatccttgctttgtaaagccagccaacctcggttcaagcgtaggtatcagcaaggca
aaagatcggcaatcgctcattcaatctattgaagaagcgtttctgtatgatcggaagctg
attattgaagaaagtattgatggaagggaagttgaaatcggagtaattggaaatgatgaa
ccgatctgctctgttgttggggaaattgctccgaaaaaagagttttacgattataaagcg
aaatatgaagacggagatacggagctcattattccagctgacataacggaagagcaatat
gaacaaatcaaaaaaatggcgctgaaagcatttaaagctatcgatggttctggacttgtt
cgggcagactttttcttgagaaaagacggaacaccgttgatcaatgaagtgaacacaatg
cctggatttacgccgtttagcatgttccctcttttatggaagcacagcggcatcgattat
ccggcgttgattgaaaaattggttcagcttggaatcgagcgatatgaactaaaacagaga
atcaagtatactatttaa

DBGET integrated database retrieval system