KEGG   Aeribacillus pallidus: AP3564_06795Help
Entry
AP3564_06795      CDS       T04993                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
apak  Aeribacillus pallidus
Pathway
apak00473  D-Alanine metabolism
apak01100  Metabolic pathways
apak01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AP3564_06795
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AP3564_06795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apak01011]
    AP3564_06795
Enzymes [BR:apak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AP3564_06795
Peptidoglycan biosynthesis and degradation proteins [BR:apak01011]
 Precursor biosynthesis
  Racemase
   AP3564_06795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ASS89991
UniProt: A0A223E472
LinkDB All DBs
Position
1397274..1398428
Genome map
AA seq 384 aa AA seqDB search
MQNYFRDTWAEINLDHIEANIHGLKEHLPNETEIIAVVKANAYGHGDVEVAQAALSAGVS
KLAVAFLDEALKLRQAGIKAPILVLGAVRPEDVTVAGENGISVTAYSAEWLESAGKYLGK
TSVNIHLKLDTGMGRIGIRDKKELEQAISLIKGQQLFRLEGIFTHFATADEHDTAYFEQQ
YERFLELLQIVDTDGLIIHCANSAATLRFPTKTFNAVRFGISMYGLAPSEFIKSTLPFPL
YEAFSLHSKIVHIKKIKKGEKVSYGATYAAKEEEWIGTVPIGYADGWIRKLTGSEVLVDG
RRVPIIGRICMDQLMIKLPEKKPVGTKVTLIGSQGNDMISVDEVAKRLETINYEIPCMIN
WRVPRIYIRNGGKTNVRNPLLTEK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactatttccgagatacatgggcagaaattaatttagatcatattgaagcgaac
attcatggattaaaggaacatttgccgaatgaaactgaaattattgctgttgtgaaagct
aatgcttatggtcatggagatgtggaagttgcccaagcagcattgtcagcaggtgtttct
aaattagcagtcgcttttctagatgaagcattgaaattgagacaagcaggaataaaggcc
cctatcctcgttttaggagcggtaagaccagaagatgttacagttgcaggagaaaatggg
ataagtgtgactgcctattcagctgaatggctggaaagtgcgggaaaatatttagggaaa
acatcagtcaacatccacttgaaattagacacaggtatgggacggatcggaataagagat
aaaaaagaactcgaacaagcgatttcgctcataaagggacagcagttatttcgattagaa
ggtatattcactcattttgccacagcagacgaacacgatacagcatattttgaacagcaa
tatgaacgtttcctggaattattgcaaatcgtggatacagacggtttgattattcattgt
gcaaacagtgctgcgactcttcgctttccaacaaaaacttttaatgcggttcgctttggc
atttccatgtatggtttggcgccatcggaatttatcaagagcacgctgccttttccgtta
tatgaagccttttctttacactcaaagattgttcatattaaaaaaataaaaaaaggggaa
aaagtaagttacggagcaacatacgcagcgaaagaggaggaatggattggtacggttcca
atcggttatgctgatggatggattcgaaaattgactggttcggaagttcttgtcgatgga
aggcgcgttcctattatcgggcgcatttgcatggatcaactgatgattaagcttccggaa
aaaaaacctgtcgggacaaaagtgacacttatcggttcacaaggcaatgacatgatttca
gttgatgaagtggccaaacggctggaaacgattaattatgaaattccatgcatgatcaat
tggcgggttcctcggatttatataagaaatggaggcaaaacaaacgtaagaaatcctctg
cttactgaaaaatga

DBGET integrated database retrieval system