KEGG   Aeribacillus pallidus: AP3564_08545Help
Entry
AP3564_08545      CDS       T04993                                 

Definition
(GenBank) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
apak  Aeribacillus pallidus
Pathway
apak00340  Histidine metabolism
apak01100  Metabolic pathways
apak01110  Biosynthesis of secondary metabolites
apak01230  Biosynthesis of amino acids
Module
apak_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AP3564_08545
Enzymes [BR:apak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     AP3564_08545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG DNA_pol_B_thumb
Motif
Other DBs
NCBI-ProteinID: ASS92328
UniProt: A0A165WP61
LinkDB All DBs
Position
1774054..1774692
Genome map
AA seq 212 aa AA seqDB search
MLTIAMPKGRIFSEAVELLRKSGYKLPDEFDESRKLILTVPEENIRFILAKPMDVGTYVE
HGVADVGIAGKDVMMEEERDVFEVLDLKISKCHLAVAGLPDTKMNDIAPKVATKYPNVAS
KYFREQGEQVEIIHLNGSIELAPLIGLADRIVDIVSTGRTLKENGLVEFEHIADITSRLI
VNPVSYRMKDKPIDMLVERLAKTVEEGKEDSD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgattgcgatgccgaaagggcgaattttttcagaagctgtcgaactattaaga
aaatcaggctacaagcttccagacgaatttgatgaatcgagaaaactaattttgaccgtg
ccggaagaaaatattcgctttattttggcgaagccgatggatgtcggaacatatgtagag
catggtgttgcagatgttgggatcgccggaaaggatgtcatgatggaagaagagcgggat
gtttttgaagtgcttgatttgaaaattagcaaatgtcatctagctgtcgccggactgcct
gatacgaaaatgaatgacatcgctccaaaggtggcgacaaaatatccaaatgtggcatct
aaatattttcgagagcaaggggagcaggtcgaaatcattcatttgaatggatcgatcgag
ctggcgccattgattggactggctgacagaattgtcgatattgtttcgacgggaagaacg
ttaaaagaaaacggattagtagaatttgaacatattgctgacatcacttcaagactcatt
gtcaatcccgtcagctatcggatgaaggacaagccgatcgacatgcttgtggagcggctt
gccaaaacagtggaagaaggaaaggaggattcggattga

DBGET integrated database retrieval system