KEGG   Aeribacillus pallidus: AP3564_08575Help
Entry
AP3564_08575      CDS       T04993                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
apak  Aeribacillus pallidus
Pathway
apak00340  Histidine metabolism
apak01100  Metabolic pathways
apak01110  Biosynthesis of secondary metabolites
apak01230  Biosynthesis of amino acids
Module
apak_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AP3564_08575
Enzymes [BR:apak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     AP3564_08575
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     AP3564_08575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG Adeno_E3_CR1
Motif
Other DBs
NCBI-ProteinID: ASS90278
UniProt: A0A223E4T8
LinkDB All DBs
Position
1778672..1779289
Genome map
AA seq 205 aa AA seqDB search
MNIAELKFDENGLIPAVVQDAVSKEVLTVAYMNEESLKKTLETKETWFYSRSRQKLWHKG
ETSGNTQTVQEIRYDCDKDALVVLVIPNGPACHTGQYSCFSKESGGQVDGSRFDIINKLE
AVIAEREAERPEDSYTTYLFEKGLDKILKKVGEEASEVIIAAKNRSHDELKWEAADLLFH
LLVLLREQKLPLDEVLTVLKERHEK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatagcagaactcaaattcgatgaaaatggacttattcctgcggttgttcaagat
gctgttagcaaagaagtgttaacagtagcttatatgaacgaagagtcgctaaaaaaaaca
ttggaaacgaaggaaacatggttttacagccgttctcgccaaaaactttggcataaagga
gaaacgtccggcaatacacaaactgttcaagagatacgctatgactgtgacaaggacgcg
cttgtcgtgctggtaatcccgaatggtccggcctgccatacagggcaatacagctgtttt
tcaaaagaaagtggcggccaggtggacggtagccgttttgatattattaacaagctggag
gccgtcattgctgaacgtgaagctgagcgtccggaagattcttatactacctatttgttt
gaaaaaggcttggacaaaattttaaaaaaggttggagaagaagcttcagaggtcattatt
gcagcaaaaaaccgcagccatgatgagctgaaatgggaagccgcggatttattatttcat
ttgcttgttctgctgcgcgagcaaaagcttccgctcgatgaagtattgacagttttaaaa
gaaagacatgaaaaataa

DBGET integrated database retrieval system