KEGG   Aeribacillus pallidus: AP3564_12820Help
Entry
AP3564_12820      CDS       T04993                                 

Definition
(GenBank) phosphatidylglycerophosphatase A
Organism
apak  Aeribacillus pallidus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PgpA YaaC
Motif
Other DBs
NCBI-ProteinID: ASS90986
UniProt: A0A167YX33
LinkDB All DBs
Position
2668220..2668735
Genome map
AA seq 171 aa AA seqDB search
MAYSLEKLQKKAIELLEDRGVTLKDIGQIVLELQKKYIPDLSLEECTYHVEKILRKREII
HAVLTGIALDKLAEQKLLPEPLQQIIESDEPLYGIDEILSLSIVNVYGSIGFTNYGYLDK
EKFGIIKELNNSHDGKVNTFLDDIVAAIAASAASRIAHNNEDVNDKLEEIK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattcacttgaaaagctccaaaaaaaagcgattgaattgttggaagatcgggga
gtaacattaaaagacattggacaaatcgtgttggagctgcaaaaaaaatacattcccgat
ctgtctcttgaagaatgcacataccatgttgaaaagattttaagaaaacgagaaatcatt
catgctgtcttgacaggaattgctttagacaagcttgcggaacaaaaattgcttcctgaa
ccacttcagcaaattatcgaatcagatgaaccgctatatggaattgatgaaattttatcg
ttatcgattgtaaatgtttatgggtcaattggatttacgaattatggctatttagacaaa
gaaaaatttggaatcatcaaagagctgaacaatagccatgacgggaaagtcaatacattt
ttagacgatatcgtggcagccattgctgcaagtgcagctagccgcattgctcataataac
gaagatgtaaatgataagctggaagagataaaataa

DBGET integrated database retrieval system