KEGG   Aeribacillus pallidus: AP3564_13830Help
Entry
AP3564_13830      CDS       T04993                                 

Definition
(GenBank) alpha-amlyase
Organism
apak  Aeribacillus pallidus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase GHL10 5TM-5TMR_LYT
Motif
Other DBs
NCBI-ProteinID: ASS91157
UniProt: A0A223E7B5
LinkDB All DBs
Position
2880969..2882501
Genome map
AA seq 510 aa AA seqDB search
MGNRVFALFMLPFLLFCAVPVQAAEKEERTWQDEAIYFIMVDRFNNMDPTNDQDVNVNDP
KGYHGGDLKGVTAKLDYIKDMGFTAIWLTPIFKNEPGGYHGYWIQDFYKVDPHFGTMEDL
KTLVKEAHKRNMKVILDFVANHTGYHHPWLNDPAKKDWFHEKKEIFDWNNQKQVENGWVF
GLPDLAQENPQVKRYLINMAKWWIKETDIDGYRLDTVKHVPKSFWQEFAKEVKSVKKDFF
LLGEVWNDDPRYIADYGKYGIDGFVDYPLYNEITKVFSKRDQSLRPLYDVWEYDKTFYDR
PYLLGTFLDNHDTVRFTRLAIENKQNPITRIKLGLTYLFSAPGIPIMYYGTEIAMDGGND
PDNRRLMNFRTDKEIIDYIKKLGELRQQLPSLRRGDFTLLYEKNGMAAFKRTYKDETAVI
AINNTGKTRKVHLTNNQLAPGKELRGLLAGDLVRSDRDGYDLILNRETAEIYVLAKKTGL
NIPFIATLIAIYVLFGLFLYYVKKRSKQTT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggggaatcgagtattcgctttatttatgcttccgtttcttcttttttgtgcggttccg
gtacaagctgctgaaaaagaagaacggacatggcaagatgaggcaatttattttattatg
gtcgaccgctttaacaacatggatccgacgaatgaccaagacgttaatgtcaatgatcca
aaaggatatcacggcggtgatttaaaaggagtgaccgccaaactagactacattaaagat
atgggatttacggcgatttggctgacaccgatttttaaaaatgaaccgggcggctatcat
ggctattggattcaagacttttacaaagtcgatccgcattttggcacgatggaagattta
aaaacgttagtgaaagaagcgcataaacgcaacatgaaggtgattctggattttgtcgcc
aaccataccggctaccaccatccatggctgaatgacccggcaaaaaaggattggttccat
gagaaaaaagaaattttcgattggaataaccaaaagcaagtagaaaacggctgggtgttc
ggactgcctgatttagcgcaagaaaatccacaagtaaagcgctatttaatcaatatggcc
aaatggtggattaaagaaacggacattgacggttatcgccttgatacagtcaaacacgtc
ccgaaatcgttttggcaagagtttgccaaagaagtgaaatcggtgaaaaaagactttttc
ctgcttggagaagtatggaatgatgacccgcgttatattgccgactatggaaaatacggc
atcgacgggtttgtcgattatccgctttacaacgaaatcacgaaagtgttcagcaagcgc
gatcaatcgttgcggccgctttacgacgtatgggagtatgacaaaacattttacgatcgc
ccgtatttgcttggaacatttttagacaatcatgatacggtacgttttacaagacttgcg
atagaaaataagcaaaatccaataacgagaattaagctcggtttaacgtatttgttctct
gcaccgggcattccgattatgtattatggaacagaaattgcaatggacggcgggaacgat
ccggataatcgtcgcttaatgaatttccgtactgacaaggaaatcattgattatattaaa
aaattaggggaactgcgccaacagctaccatcgctacggcgcggcgattttacattgtta
tatgaaaaaaacggtatggctgcctttaagcggacgtataaagacgaaacagcggtcatt
gccattaacaataccggaaaaacacgaaaggttcatttgacaaacaatcaacttgccccg
ggaaaagaactacgcggactgctggcaggagatttagtccgaagcgatcgcgacggatat
gatctcattttaaatcgcgagacagcggaaatttatgtgcttgcgaaaaagacggggctc
aatattccatttattgcaacgttaattgccatttatgtgctatttgggttgtttttatat
tatgtaaagaaaaggtcaaaacagacaacctag

DBGET integrated database retrieval system