KEGG   Aeribacillus pallidus: AP3564_18735Help
Entry
AP3564_18735      CDS       T04993                                 

Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
apak  Aeribacillus pallidus
Pathway
apak03410  Base excision repair
apak03430  Mismatch repair
apak03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:apak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AP3564_18735
   03430 Mismatch repair
    AP3564_18735
   03440 Homologous recombination
    AP3564_18735
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:apak03400]
    AP3564_18735
Enzymes [BR:apak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     AP3564_18735
DNA repair and recombination proteins [BR:apak03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     AP3564_18735
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AP3564_18735
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AP3564_18735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ssDNA-exonuc_C RecJ_OB DHHA1 DHH
Motif
Other DBs
NCBI-ProteinID: ASS92020
UniProt: A0A223E9Z1
LinkDB All DBs
Position
complement(3871936..3874314)
Genome map
AA seq 792 aa AA seqDB search
MLRSKFRWNRLYRDESNEEAVRALIDSLNITYLTARLLVNRGIQNVEEAKEFLHIKEPSF
HDPFLLDGMERACERIFAAIRAGEKIVVYGDYDADGVSSTAVLLTALKELGANVDFYIPN
RFSEGYGPNEHAFRMIHEKGCRLIITVDTGIAAINEADLAKRLGIDLIITDHHEPGPVLP
DAYAIIHPKLPNSTYPFKELAGVGVAFKMAHALYGKVPESLIEIAAIGTIADLVPLYGEN
RLLAKKGIEKLKTTTRPGINSLLSIAGVDKSSVNEETIGFVLGPRINAAGRLKEADPAVE
LLLTDDEEKADMLAKEIDQLNKQRQKLVQEITDEAIKEIEKNFPIEDNPVLVVAKENWNS
GVIGIVASRLVEKFYRPAIVLSIDRETGLAKGSARSIQGFDLFKNLSECRELLPHFGGHT
MAAGMTLKAEHIDELRQKMIDLANSQLSDEDFIPVKNIECACSLEHVTIKAVEELEKLAP
FGVDNPKPLFLLENVNAADVRKIGVNGNHLKMKIEEKEFELDVVGFGQGELAEEISPFAN
VSIVGELAINEWNYVKKPQLLLQDLAVPAWQLFDWRGSRGTEALLSKLPAEKRLLIAFHE
ESIKLYKDQPYIHEIHIISEIKDYKNIDVSNKYVVFLDMPPAIEFLVSAFEQGMPERIYA
IFYQHADHFFQTMPTREHFKWYYAFLTKKNSFDYKKYGEDLAKYRGWTKETIFFMTKVFF
ELEFVTINNGVITLNKKVKKRDLSESGTYQQKLDQMKLEQQLLYSSYQELKEWFEKAVLK
RDADKFLQVHEW
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgctgagatctaaatttcgttggaatcgtttatatagggatgagtccaacgaagaggct
gttcgagcattaatcgactctttgaatattacatatttgactgctcgattacttgtgaat
cgcggcattcaaaatgttgaagaagcaaaagagtttttacatataaaggaaccttcattt
catgatccttttttgttggatgggatggagcgggcatgtgagcgtatttttgcagcaatc
cgcgctggtgaaaagattgtcgtatacggtgattatgatgcggacggcgtttccagcact
gccgtcctgttgacggcattaaaggaattgggggcaaacgtcgatttttacataccgaat
cgattttcagaaggatacgggccaaacgaacatgctttccgaatgattcatgaaaaagga
tgcaggctgattataacagttgataccggcatcgcggcaatcaatgaagcggatttagcc
aaaaggcttggaatcgacctcattatcacagaccatcatgaaccggggcctgttttgcct
gatgcgtatgcgatcattcatccgaaattgccaaattcaacatatccttttaaggagctg
gcaggtgtaggcgttgcttttaaaatggcccatgccctttatggaaaggttccagaatct
ctgatagagatcgcagccattggaacaattgctgatttagtacctctatacggagaaaat
cggcttcttgcgaaaaaagggattgaaaaattaaaaacgacgacaagacctggcataaat
tcgcttctttccattgctggagtggacaaatcttccgtaaatgaggaaacgataggattt
gttttaggaccgagaatcaatgcggcagggaggctgaaagaagccgatcctgccgttgaa
ttgttgttgacagatgatgaagaaaaagctgatatgcttgctaaggaaatcgatcaatta
aataaacaaaggcagaagcttgtacaagagataacggacgaagcgattaaggaaattgaa
aaaaattttccaatcgaagacaatcctgttttagtcgtcgcaaaagaaaactggaattct
ggagtgatcggaatcgttgcttccagattggtcgaaaaattttaccgtcctgccatcgtg
ttgagcattgatcgtgagacaggtcttgccaaagggtctgcgcgaagcattcaagggttt
gatctatttaaaaacttatcggaatgcagggagcttctccctcattttggaggccatacg
atggctgctggcatgacgctgaaagcagagcatattgacgagctgcgccaaaaaatgatc
gatcttgcaaatagtcagctttcagatgaagattttattcctgtaaaaaacattgaatgt
gcctgttcattggagcatgtcacaataaaagcagtcgaagagctggagaagcttgcccct
ttcggagtcgataatccgaagccgctctttttactagaaaatgtcaatgcagcagatgtt
agaaaaattggggtaaacggaaatcatttgaaaatgaagattgaggagaaggaatttgaa
ttagatgtcgtcggctttggacagggagaattggcagaagaaatatctcctttcgcaaac
gtttctattgtcggtgagcttgcgatcaacgaatggaattatgtaaaaaagccgcagcta
ttgcttcaagaccttgccgtgccagcgtggcagctttttgattggcgaggttcaagagga
acggaggctttgctctctaaacttcctgctgaaaaacgattgctgatcgcctttcatgaa
gaatctataaaattatataaagatcaaccgtacattcatgaaattcatataatatcagaa
ataaaggattacaaaaatatagatgtttccaataagtatgttgtatttctcgatatgccc
ccggcaatcgaatttcttgtttcagcatttgagcaaggaatgcctgaaagaatttatgct
attttttatcagcatgcagaccacttttttcaaacaatgccgacaagagagcattttaaa
tggtattacgcattcttaacgaaaaaaaattctttcgattacaaaaaatatggggaagat
ttagccaaataccgtggctggacgaaagaaacgatcttttttatgacaaaggtgtttttt
gaacttgaatttgttacaataaacaatggtgtgattacattaaacaaaaaggtgaaaaaa
cgggatttatcagaatccggaacatatcagcagaagctggatcaaatgaaactggaacag
cagcttctctattcttcttatcaagaactgaaggaatggtttgaaaaggcagtcttgaaa
cgagatgccgataaatttttacaagttcatgaatggtaa

DBGET integrated database retrieval system