KEGG   Aeribacillus pallidus: AP3564_18775Help
Entry
AP3564_18775      CDS       T04993                                 

Definition
(GenBank) hypothetical protein
Organism
apak  Aeribacillus pallidus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2905 Ninjurin
Motif
Other DBs
NCBI-ProteinID: ASS92028
UniProt: A0A165XN02
LinkDB All DBs
Position
complement(3882166..3882366)
Genome map
AA seq 66 aa AA seqDB search
MTEFPKLLMVLGGILLFIGLFMQVVGRLPGDIVVKKGNFTFFFPIVTCIVISLLLTFIFS
FLGRFK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgacggaatttccaaagctattgatggtgcttggcggtattttgctttttatcggctta
tttatgcaagttgtcggcagactgccaggagatatcgtggtaaaaaaaggaaattttacc
ttcttctttccgattgtcacatgcattgtcattagtttgcttttaacgttcattttttct
tttttaggacggtttaaataa

DBGET integrated database retrieval system