KEGG   Aeribacillus pallidus: AP3564_19130Help
Entry
AP3564_19130      CDS       T04993                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
apak  Aeribacillus pallidus
Pathway
apak00020  Citrate cycle (TCA cycle)
apak00190  Oxidative phosphorylation
apak00650  Butanoate metabolism
apak01100  Metabolic pathways
apak01110  Biosynthesis of secondary metabolites
apak01120  Microbial metabolism in diverse environments
apak01130  Biosynthesis of antibiotics
apak01200  Carbon metabolism
Module
apak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AP3564_19130
   00650 Butanoate metabolism
    AP3564_19130
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AP3564_19130
Enzymes [BR:apak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AP3564_19130
    1.3.5.4  fumarate reductase (quinol)
     AP3564_19130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4_18 Fer4 Fer4_20 Fer4_4 Fer4_13 Fer4_21 Fer4_3 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ASS92094
UniProt: A0A165YL18
LinkDB All DBs
Position
complement(3957014..3957778)
Genome map
AA seq 254 aa AA seqDB search
MSEKKVRFIITRQDRPDTEPYQEEFEVPYRPNMNVISALMEIRRNPVNAKGEKTTPVTWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLEPMRTFPVIRDLQVDRSRMFDSLK
KVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLEACPNVNSKSNFIGPAPLS
QVRLFNAHPTGAMHKSERLEAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRETTV
HAFRKMFGSDYIDS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaaaagtgcggtttattatcactagacaggatcgaccagacacggaacca
tatcaagaagaatttgaagtgccatatcgtccgaatatgaacgttatttcggccttaatg
gaaattcgccgtaatcctgttaatgccaaaggcgaaaaaacaacgcctgtaacatgggat
atgaactgtttagaggaagtatgcggtgcttgttcaatggtcattaacgggaagccccgc
caatcatgtacagcgcttattgatcagctggaacagcctattcgtctcgagccgatgcgc
acattcccggttattcgcgatcttcaagtagaccgcagccgcatgtttgactctttgaaa
aaagtaaaagcatggataccaattgacggtacgtatgacttaggaccaggaccaagaatg
cctgagaaaaaacgccaatgggcatacgagctttcaaaatgtatgacgtgcggcgtatgc
cttgaagcttgtccaaacgtaaacagcaaatcgaacttcatcggtccagcgccattatca
caagttcgtttgtttaacgctcatccgacaggcgcgatgcataaatcagaacggttggaa
gctattatgggcgacggcggacttgcgaactgcggaaattcccaaaactgcgttcaatcc
tgtccaaaaggaattccgcttacaacatcgattgcagcattaaatagagaaacaactgtt
cacgcatttcgtaaaatgttcggaagcgactatattgacagctga

DBGET integrated database retrieval system