KEGG   Aeribacillus pallidus: AP3564_19135Help
Entry
AP3564_19135      CDS       T04993                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
apak  Aeribacillus pallidus
Pathway
apak00020  Citrate cycle (TCA cycle)
apak00190  Oxidative phosphorylation
apak00650  Butanoate metabolism
apak01100  Metabolic pathways
apak01110  Biosynthesis of secondary metabolites
apak01120  Microbial metabolism in diverse environments
apak01130  Biosynthesis of antibiotics
apak01200  Carbon metabolism
Module
apak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AP3564_19135
   00650 Butanoate metabolism
    AP3564_19135
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AP3564_19135
Enzymes [BR:apak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AP3564_19135
    1.3.5.4  fumarate reductase (quinol)
     AP3564_19135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ASS92095
UniProt: A0A161W8A2
LinkDB All DBs
Position
complement(3957808..3959559)
Genome map
AA seq 583 aa AA seqDB search
MSKGKLIVVGGGLAGLMATIKAAEAGVSVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTIYGGDFLANQPPVKAMCEAAPGIINLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWEFLGIIQDDEGRCRGIVAQDLK
SMEIQAFRSNAVIMATGGPGIIFGKSTNSVINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFHVCVDLK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGEDPRKVPMKIFPAVHYSMGGLWI
DYDQMTNIPGLFAAGECDYSQHGANRLGANSLLSAIYGGMVAGPKAVEYMNGLEKSADDL
PSTLYDARVKEEQSKWDEILKMDGNENAYVLHKELGEWMTDNVTVVRYNDKLLKTDEKIQ
ELMERWERININDTAKWSNQGASFTRQLRNMLVLARVITLGAYNRNESRGAHYKPEFPER
NDEEWLKTTMATFAGLKEAPKFHYEDVDVSLIKPRVRDYTKKH
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaggaaaattaattgttgtcggcggcggcttggctggcttaatggcaactata
aaggctgcggaagccggggtgtctgttgacttattctcgttagtacctgtaaaacgttcc
cattcagtatgtgctcaaggagggatcaacggggcggtaaatacgaaaggagaaggagac
tctccgtggatccattttgatgatacgatttatggcggagactttttggctaaccagcca
ccggttaaagcgatgtgtgaagcagcaccgggaattattaaccttttagatcgcatgggt
gttatgtttaaccgtacaccagaagggttgttggatttccgtcgttttggaggaacacag
catcaccggacagcgtttgccggagcaacaactggacaacagcttttatatgcattggac
gagcaagttcgacgtcacgaagtagcaggtcttgtgacgaaatatgaaggctgggagttt
ttaggaatcatacaagatgatgaaggacgctgccgcggtatcgttgctcaagatttaaaa
tcaatggagattcaagctttccgttcgaatgccgtaataatggcgacaggaggacctgga
attatctttggtaaatcaacaaactctgtgattaatacgggatcggctgcttctatcgtt
tatcagcaaggagcttattatgcaaacggggaatttatacaaattcatccgacagccatc
cctggagatgacaagcttcgattaatgagcgagtctgcacgcggcgaaggcggaagaatt
tggacatataaagacggaaaaccatggtatttccttgaagaaaaatatccggcatatgga
aaccttgttcctcgtgatattgcaacgagagaaatattccatgtatgtgtagacttgaaa
ttaggcattaatggcgaaaacatggtatatcttgatctttctcataaagatccaaaagag
cttgatattaaactaggcggtattatcgaaatttatgaaaaattcatgggtgaagatcca
agaaaagtgccgatgaaaattttcccagccgtccattattctatgggaggtctatggatc
gattacgatcaaatgacaaacatccctggtttgtttgcagctggtgaatgcgattactct
cagcatggtgcgaaccggcttggagcaaactcattgctttctgcaatttacggtggtatg
gttgcaggaccaaaagctgttgaatatatgaatggattggaaaaatcagctgacgattta
ccatccacattatatgatgcacgcgtaaaagaagaacaaagcaaatgggacgaaatcctg
aaaatggatggaaacgaaaatgcttacgttcttcataaagagcttggtgaatggatgacg
gataatgttacagtcgtgcgctacaatgataaacttctaaaaacagatgaaaaaattcaa
gagcttatggaacgttgggaaagaattaatattaacgatactgcgaaatggagcaaccaa
ggcgcaagctttactcgccagttgagaaacatgcttgtgttggctcgggttattacgctt
ggggcttataaccgtaatgaaagccgaggtgctcactataaaccagaatttccggaacga
aatgatgaagagtggctcaaaacaactatggcaacgtttgccggcttgaaggaagctcct
aaattccactacgaagatgttgatgtatcactcattaagcctcgtgtgcgtgactatacg
aagaaacattaa

DBGET integrated database retrieval system