KEGG   Aeribacillus pallidus: AP3564_19365Help
Entry
AP3564_19365      CDS       T04993                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
apak  Aeribacillus pallidus
Pathway
apak00020  Citrate cycle (TCA cycle)
apak00480  Glutathione metabolism
apak01100  Metabolic pathways
apak01110  Biosynthesis of secondary metabolites
apak01120  Microbial metabolism in diverse environments
apak01130  Biosynthesis of antibiotics
apak01200  Carbon metabolism
apak01210  2-Oxocarboxylic acid metabolism
apak01230  Biosynthesis of amino acids
Module
apak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apak_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:apak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AP3564_19365
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AP3564_19365
Enzymes [BR:apak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AP3564_19365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASS92136
UniProt: A0A223EA49
LinkDB All DBs
Position
complement(4008214..4009485)
Genome map
AA seq 423 aa AA seqDB search
MAEGQKITMTNGTLNVPNDPIIPFIEGDGTGPDIWRAASKVLEAAVEKAYNGEKKIVWKE
VLAGEKAFKETGEWLPQETLDVIREYMIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFNGVPSPVKRPQDTDMVIFRENTEDIYAGIEYAKGTEEVKKVIEFLQKELGVNKIR
FPETSGIGIKPISEEGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EQEFGDKVFTWAEYDRIVEKEGKEAANKAQEEAEKAGKIIIKDAIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLMLEHLGWKEAADLIIQAMEKTIASKVVTYDFARLMDGATEVKCSEFGNELIK
NMG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaggtcaaaaaattacaatgacaaatggtactttaaacgttccaaatgatcct
ataattccgtttattgaaggagacggcactggtcctgatatttggagagctgcgtcaaaa
gtgctggaagcagctgtagaaaaagcatacaatggcgaaaagaaaatcgtttggaaagaa
gtgcttgctggtgaaaaagcttttaaagagactggggaatggcttcctcaagaaacgctt
gatgtgatacgcgagtatatgattgcgatcaaaggtccgttaacaactcctgtaggtgga
ggaatccgttctttaaacgttgctcttcgccaagagctggatttatttgtgtgcttaaga
cctgtccgttatttcaatggagttccttcccctgtaaaacgtcctcaagatacagacatg
gtaattttccgtgaaaataccgaagacatctatgccggcatagagtatgcaaaagggaca
gaagaagtaaaaaaagtcattgaatttttacaaaaagagctgggagtaaacaaaatccgt
ttccctgaaacgtctggaatcggcattaagcctatttctgaagaaggaacgaaacgtctt
gtccgggcggccattaactatgcaattgaacacggaagaaaatctgtcacccttgttcat
aaagggaacattatgaaatttacagaaggcgcgtttaaaaattggggatatgaattggct
gagcaagagtttggcgataaagtattcacatgggctgagtatgaccgcattgttgaaaaa
gaaggaaaagaagcggctaacaaagcgcaagaagaagcagaaaaagctggaaaaattatt
attaaagatgcaattgcagatattttcctacagcaaattcttactcgtccgcgcgagttt
gatgtagtagcaacgatgaatttaaatggagactacatttcggatgctttggctgcacaa
gtaggtggaatcggtattgctccaggagcaaacattaactacgagacagggcatgcgatt
tttgaagcaacacacggtacagcaccaaaatacgccggacttgataaagtgaatccatct
tccgtaattctttctggagtgcttatgctcgaacatttaggctggaaagaagcagctgat
ttaatcattcaagcaatggaaaaaacgatcgcttcaaaagttgtcacctatgactttgca
cgcctcatggacggagctacggaagtaaaatgctctgaattcggcaatgaattgattaaa
aacatgggttaa

DBGET integrated database retrieval system