KEGG   Candidatus Puniceispirillum marinum: SAR116_0393Help
Entry
SAR116_0393       CDS       T01207                                 

Definition
(GenBank) DNA primase
  KO
K17680  twinkle protein [EC:3.6.4.12]
Organism
apb  Candidatus Puniceispirillum marinum
Brite
KEGG Orthology (KO) [BR:apb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:apb03029]
    SAR116_0393
Enzymes [BR:apb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAR116_0393
Mitochondrial biogenesis [BR:apb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    SAR116_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C Toprim_2 Toprim_4 ATPase Toprim_3 Toprim AAA_19 AAA_25 MobB MeaB AAA_30 CbiA ParA AAA_22 DUF2387 AAA UvrD-helicase AAA_16 DUF815 NTPase_1 AAA_24 T2SSE
Motif
Other DBs
NCBI-ProteinID: ADE38636
UniProt: D5BQS2
LinkDB All DBs
Position
complement(416518..418218)
Genome map
AA seq 566 aa AA seqDB search
MQITNDEQTEFIRHESCPKCGSSDALAVYGDSATQEVHHGWCFSCQTFQKGDNVDGSYTN
TPKRNSSSANLLDGEYNEIKSRGLTEETCRKFNYTTAIHNGEPVQVATYLDENGRPVAQK
VRTKSKKFTMLGDAKAATLYGSHLYKTGKKLVICEGEIDAMTVSQVQGHKWATVSLTQGC
SSAVKTMKNNWEFITKFEEVILMFDMDSVGQKAAQEAAATLPVGKAKIAYLPCKDANECL
LQGKSAEIIQAIYQAREYRPDGIVVATDYRDVISEDDQASSVTYPYSNLNEIFRGLRLKE
ILLVAAGSGTGKTTFVKEIAYHLHQQGERVGLIMLEESNKRSLLSLVGTHMNKNVLVDRS
EVTDDEIIEAFDDLFGEGRNPVYLYDHWGSSDVDLICQRITYMAKVLGIKWVFLDHISML
CTQMGGSSGFGSERLIIDYAMTKLRTMVQELDIGLILVSHVKRPDGNSGHESGGQPVRLN
HLRGSSSLGQLSDGVIALNVDSDEPDSDIRHLHILKNRFCGATGYSGTLRYDRDTSRLVE
EELAHLFEQEEDDEETEEAQQTGDSA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcacaaatgacgaacaaacggaattcatccgacatgaaagttgccccaaatgt
gggtcgtcggatgcgcttgcagtctatggcgatagtgccactcaagaagtacatcatgga
tggtgcttctcttgtcagacttttcagaaaggagacaacgtggacggatcatatacgaat
acgccaaagcggaattcatctagcgcaaatctactagatggcgaatacaacgagatcaaa
tcgcgtggactgacggaagagacatgccgaaagttcaactatacgacagctatccacaat
ggtgagcctgtccaagttgcgacctatctagatgaaaacggacgtcctgtagcacagaaa
gtacggacgaaatccaagaagttcaccatgctaggagatgcgaaagccgcaaccctgtat
ggaagccacttatataagactggcaagaagctggtcatatgcgaaggcgaaatcgacgca
atgaccgtatcacaggttcaaggccataagtgggcgactgtatccttaactcaaggatgc
agttcggctgttaagaccatgaaaaacaactgggaattcataaccaagtttgaggaagtt
atcctcatgtttgatatggactcagttgggcagaaagccgcccaagaagcggcggcaact
cttccagtaggtaaggcgaaaatcgcctatctaccgtgcaaagatgcaaatgaatgtcta
ctgcaaggcaagtcagccgaaatcatccaagctatctatcaggcgcgagaataccgtcct
gatgggattgtggtggcaacagattatcgtgacgtcatcagtgaggatgaccaagcgtca
tcagtgacctatccatattcaaatctgaacgaaatatttcgtggtttgagactgaaggaa
attcttctagttgctgccggaagcgggactggaaaaaccaccttcgtcaaggagatagca
tatcaccttcatcaacaaggtgagcgtgttggtcttatcatgcttgaagagtcaaacaag
cgtagcctcttatctttggtcggaacgcacatgaataagaatgtgctggttgaccggagc
gaggttaccgacgacgaaatcatagaagcattcgatgatttattcggtgaaggacggaac
ccagtgtatctttatgaccactggggcagttctgatgtcgatttgatatgccagcgcatc
acctatatggcgaaggtcttgggtatcaaatgggtattccttgatcacatcagtatgctt
tgcacccaaatgggcggaagcagtggctttggatcagaacgcctgatcatcgattatgcc
atgaccaagcttcgcactatggtgcaagaattagacattggcttgatcttggtcagccat
gtcaaacgtccagatggaaactctgggcacgaaagtggtggacagccagtacgtctgaac
cacctcaggggttcatcaagtcttggtcagctatcagatggcgtaattgccctgaatgtt
gactcagatgaaccagactctgacatccgtcaccttcacatcctcaagaaccgtttctgt
ggtgctactggctatagcggcacactcagatatgacagggacacttcacgtcttgttgaa
gaagagctggcacatttgttcgaacaggaagaagacgacgaagaaactgaagaagcacaa
caaacaggagatagtgcatga

DBGET integrated database retrieval system