KEGG   Candidatus Puniceispirillum marinum: SAR116_0609Help
Entry
SAR116_0609       CDS       T01207                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00970  Aminoacyl-tRNA biosynthesis
apb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAR116_0609
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:apb03029]
    SAR116_0609
Enzymes [BR:apb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SAR116_0609
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SAR116_0609
Mitochondrial biogenesis [BR:apb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SAR116_0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADE38852
UniProt: D5BRF5
LinkDB All DBs
Position
complement(647027..648481)
Genome map
AA seq 484 aa AA seqDB search
MSDLVAGRTGDWEVVIGLEVHAQVSSSAKLFSGAPTKFGAEPNQNVSLVDAAMPGMLPVI
NSECVYQAVRTGLGLKAEINLFSVFDRKNYFYADLPQGYQISQFKQPIVGEGILRIDLAD
GSSKDIGIERLHLEQDAGKSMHDQHPSKSYIDLNRTGVALMEIVSRPDIRSATQAAAYVR
KLRSILRYLGTCDGNMEEGSMRADVNVSVRRPGDELGTRTETKNLNSLRFIQQAIDYEVA
RQIEVIEDGGTIDQETRLFDTNTGMTRTMRSKEDAHDYRYFPDPDLLPLEITQSDVDKLA
AELPELPDSIKDRLMNDYGLSAYDAAVITEERETAAFYEAASKGRDRKLVANWMTVELFG
ALNKAGLDLARSPVSPDALGGLVDMISDGTISGRIAKDVFADMMLSGKQAADIVEEKGLK
QVSDSGAIETLIDDVMAANEDKVAEYRGGKDKLFGFFVGQVMKQSGGQANPGMVNQLLRS
KLDG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctagttgcaggtcgcacaggcgattgggaagttgtgattggtcttgaagtg
catgcgcaggtttcatcatctgccaagctgttttcaggcgccccaacaaaatttggtgct
gagcccaatcaaaatgtatctttggttgatgcggccatgccaggcatgttgccggttatc
aatagcgaatgcgtttatcaggctgttcgcaccggtcttggtctgaaagccgagataaat
ctgttcagcgtatttgaccggaagaattatttttacgcggatctgccgcaaggctatcag
attagccagttcaaacagcctatcgttggcgagggcatcttgcggattgatcttgccgat
ggatcaagtaaggatatcggtattgagcgtttgcatctggaacaggatgcaggcaaatca
atgcatgatcagcatccaagcaaaagttatattgatctgaatcgaactggcgttgccttg
atggaaattgtgtcccgacctgatattcgttcggcaacgcaagcggcggcctatgtgcgg
aaattacggtcgattctacgttatctgggtacatgcgatggcaatatggaagaaggctcg
atgcgcgccgatgtcaatgtatcggttcggcgtccaggtgatgaactgggcacgcgaacc
gagaccaaaaacctgaactcacttcgtttcatccagcaagccattgactatgaagttgcc
cgccagattgaagtcatcgaggatggaggcacgattgatcaggaaacccgtctgtttgac
accaataccggcatgacccgcaccatgcgcagcaaggaagatgcgcatgattaccgttat
ttccccgatccggatctgttgccgctagaaatcacacaaagcgatgttgataagctggcg
gcagaactgcccgaattgccagattcgatcaaagaccgcttgatgaatgactatggtcta
tccgcctatgatgcggcggttatcaccgaagaacgcgagacagctgctttctatgaagcc
gcaagtaaggggcgtgaccgcaagctggtagcaaactggatgactgttgaattgtttggc
gcgttgaacaaggccggacttgatctggcgcgttcgcccgtatcgccggatgcgcttggc
gggttggtcgatatgatcagcgatggcacgatttcggggcgcatcgccaaggatgtgttt
gccgatatgatgctgtcgggcaagcaggctgccgatattgtcgaagagaaggggctgaag
caggtgtcggatagtggtgccattgaaactctgatcgatgatgtcatggcggctaatgaa
gataaggttgccgaatatcgcggtggcaaggacaaattgtttggcttctttgttggtcag
gtgatgaaacagtctgggggtcaggccaatccgggcatggttaatcagctgttgcgctcc
aaactggatggttag

DBGET integrated database retrieval system