KEGG   Candidatus Puniceispirillum marinum: SAR116_0610Help
Entry
SAR116_0610       CDS       T01207                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00970  Aminoacyl-tRNA biosynthesis
apb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAR116_0610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:apb03029]
    SAR116_0610
Enzymes [BR:apb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SAR116_0610
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SAR116_0610
Mitochondrial biogenesis [BR:apb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SAR116_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADE38853
UniProt: D5BRF6
LinkDB All DBs
Position
complement(648481..649959)
Genome map
AA seq 492 aa AA seqDB search
MQDLLALSAVEARAALDAKDISSVELTSAYIQAAEDTASLNSYVLLTADKALDMASDADK
RMAAGNGGVLEGLPIGVKDMFCTKGVTSTACSKILDGFTPVYESTVTANMWAQGGVMLGK
LNCDEFAMGSANETSFAGPVINPWDAGDGVDLVPGGSSGGSASSVAARSALLSVGTDTGG
SIRQPASFCGIVGLKPTYGRCSRWGIVAFASSLDQAGPFSRDVADNALLLSAMASHDAKD
STSAATPLQDVVAAVNAGVKGMKIGIPREYRMDGMDSDVEKLWQQGQEWLKDAGAELVDI
SLPHTKYALPAYYIIAPAEASSNLARYDGVRYGNRIEADSLDEMYGLTRAEGFGDEVQRR
IMIGTYVLSAGYYDAYYLKAQRVRRLIKNDFDEAFATVDAILTPATPSAAFPVGRKVDDP
VINYLNDVFTVPANLAGLPGMSVPAGFNQAGLPLGLQVLAKPFDEASIYKVGKVIEDSAA
ISSMPQRMAGGA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacttgctcgctttatcagctgttgaggcgcgtgctgcccttgacgcaaaagat
atttcatcggttgaattgaccagcgcctatattcaggctgctgaagatacggcctctttg
aacagttatgttctgcttaccgcagacaaagcacttgatatggcaagcgatgccgacaaa
agaatggccgctggtaatggtggcgtcttggaaggcctgccaattggcgtcaaagatatg
ttttgcaccaaaggcgttacatcaacggcttgttcaaaaattcttgatggtttcacccct
gtttatgaaagcaccgtaaccgcgaatatgtgggcacagggcggtgtgatgcttggcaag
ctcaattgtgatgaatttgccatggggtcggctaatgaaaccagctttgccgggccggtt
ataaacccatgggatgctggcgatggtgttgatctggttccagggggatcatcaggcgga
tcagcttcgtcagtggccgcgcgatcggctttactgagtgtgggtaccgatacaggcggc
tcaattcgccagccagcctctttctgtggtattgtcgggctgaagccaacctatgggcgt
tgttcgcgctggggcattgttgcctttgcctcatcgcttgatcaggcagggccattttca
cgcgatgttgccgataacgcgctattgttgagtgcgatggcaagtcatgatgccaaggac
tcgacttcggctgccactccgcttcaggatgttgtcgcggcggttaacgcgggcgtcaaa
ggaatgaaaatcggaattccacgcgaatatcgcatggatggtatggatagtgatgttgaa
aaactctggcaacagggtcaggaatggctgaaagatgctggtgctgagctggttgatatt
tctttgccgcataccaaatacgctttgccagcttattacattattgccccggctgaggcg
tcatctaatctggcgcgatatgacggggtgcgctatggcaatcgcatcgaagcagattcg
cttgacgagatgtatgggttaacgcgtgctgaaggctttggtgatgaagtccagcgccgc
attatgattggtacttatgtgttgtctgctggttattacgacgcttattacctcaaggcc
cagcgcgtcagacgattaatcaaaaatgattttgacgaggcttttgcaacggttgatgcc
attctaacgccagcaacaccatctgccgcattcccagtgggacgcaaggttgatgatcct
gttataaattacctgaatgatgtctttacggtgccagcaaatctggctggtttgccgggt
atgtctgtgccagctggctttaatcaggcggggctacctcttggtttgcaggtgctggcc
aagccatttgacgaggcctctatatataaagttggaaaagttatcgaggactcggccgcg
ataagctctatgccgcaacgcatggcaggaggtgcgtga

DBGET integrated database retrieval system