Candidatus Puniceispirillum marinum: SAR116_0639 Help Entry SAR116_0639       CDS       T01207                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apb  Candidatus Puniceispirillum marinum Pathway apb01100   Metabolic pathways apb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SAR116_0639   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SAR116_0639 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ADE38882 UniProt:  D5BRI5 LinkDB All DBs Position complement(679191..679427) Genome browser AA seq 78 aa AA seqDB search MSDIADRVKNIVVEHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA EKILTVKDAVSFLEESAS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagatcgtgttaagaacatcgtagttgaacatcttggtgtagatgca gataaggttgttgagggcgcaagcttcatcgatgatcttggcgcagatagccttgataca gtggaattggtaatggcatttgaagaagaattcggtgtcgaaattcctgatgatgctgca gaaaaaattctcactgtgaaagacgccgtgtcattcttggaagagagcgcatcttaa

DBGET integrated database retrieval system