KEGG   Candidatus Puniceispirillum marinum: SAR116_1062Help
Entry
SAR116_1062       CDS       T01207                                 

Definition
(GenBank) Enoyl-acyl-carrier-protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00061  Fatty acid biosynthesis
apb00780  Biotin metabolism
apb01100  Metabolic pathways
apb01130  Biosynthesis of antibiotics
apb01212  Fatty acid metabolism
Module
apb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAR116_1062
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAR116_1062
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SAR116_1062
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:apb01004]
    SAR116_1062
Enzymes [BR:apb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SAR116_1062
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SAR116_1062
Lipid biosynthesis proteins [BR:apb01004]
 Fatty acid synthase
  Component type
   SAR116_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ADE39305
UniProt: D5BSQ8
LinkDB All DBs
Position
1136633..1137451
Genome map
AA seq 272 aa AA seqDB search
MNNQTTTGFMQGKRGLIMGVANERSIAWGIASKLAEQGAELAFTFQGEALQKRVVPLAAS
VGSDIVLPCDVTDEASMDALFATLADKWGKFDFVLHAIAYSDKEELKGGYVDTSRDNFSR
TMDISVYSFTDVARRATDMMNDGGALLTLTYYGAERVMPHYNVMGVAKAALEASIRYLAV
DLGGRNIRVNGLSAGPMKTLAASGIGDFRYILKWNEYNSPLKRNVTLDDVGGAGAYLLSD
LSSGVTGETHHVDCGYHVVGMKAVDAPDISVV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcaaaccacaacaggtttcatgcagggaaaacgtggcctgattatgggcgtg
gctaacgaacgttcaattgcatgggggattgcctccaagctggctgaacaaggcgcagaa
cttgccttcacctttcagggtgaggccttgcaaaagcgcgtggtaccgctggccgcctcg
gttggcagtgatattgttctgccatgtgatgttaccgatgaagccagtatggacgcgtta
ttcgcgacacttgccgacaaatggggcaagtttgattttgtgctgcatgcaattgcctat
tcggataaggaagagctgaaaggtggctatgttgataccagccgcgataatttcagccgg
acgatggatatttcagtctattcctttaccgacgttgcgcgccgcgctaccgatatgatg
aatgatggtggggcattgctgacactgacctattatggcgccgaacgcgtgatgccacat
tataatgtcatgggtgttgccaaagccgcactggaagcatctatccgctatctggctgtt
gatctgggcggacgaaatatccgcgtcaatggcctgtctgccggcccaatgaaaacgctg
gccgcatccggaattggcgatttccgctatattctgaaatggaatgaatataattcacca
ttgaagcgcaatgtaacgcttgatgatgttggcggtgccggtgcctatctgttgtcagac
ttatcgtctggtgtgaccggtgaaacgcatcatgtagattgcggctatcatgtcgtcggc
atgaaggcggttgacgcgccagatatttctgtagtgtga

DBGET integrated database retrieval system