KEGG   Candidatus Puniceispirillum marinum: SAR116_1612Help
Entry
SAR116_1612       CDS       T01207                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00240  Pyrimidine metabolism
apb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAR116_1612
Enzymes [BR:apb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SAR116_1612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: ADE39855
UniProt: D5BUA8
LinkDB All DBs
Position
1783150..1783758
Genome map
AA seq 202 aa AA seqDB search
MAKLYFSYSAMNAGKSTILLQASHNYKERGMNTVLLTARLDDRIGQGEDGKGKIGSRIGL
QADAEMFDDSTDIFALATELSRDSDIACIMVDEAQFLTIAQVWQLSAIADELGIPVMCYG
LRTDFQGQLFDGSATLLAIADVLREIRTICHCGRKATMVVRQDADGKPITDGAQIEIGGN
DKYVSLCRRHWKAAMAKVAESD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttatatttttcttattcggcgatgaatgcgggcaaatcgacgatcctgtta
caggcttcgcataattataaagaacgcggcatgaacaccgtgcttctgaccgcgcgcctt
gatgaccggattggccaaggcgaggatggcaaaggcaagattggctcgcgcattggctta
caggccgacgccgaaatgttcgatgatagcaccgatattttcgctcttgccacagagctg
tcccgtgatagcgacatcgcctgtatcatggttgacgaagcacaatttctgaccattgcc
caggtctggcaattaagtgcgattgccgatgagcttggcattccggtcatgtgttacggc
ctgcgcactgattttcagggacagcttttcgacggcagtgccaccttgctggcgattgcc
gatgtgttgcgtgaaatccgcacgatatgccattgcgggcgcaaagccacgatggtcgtg
cgtcaggatgctgatggcaagccgatcactgatggtgcacagatcgaaattggcggtaat
gataaatatgtctcgctatgccgcaggcactggaaagcggcgatggcaaaagtcgccgag
tctgactga

DBGET integrated database retrieval system