KEGG   Candidatus Puniceispirillum marinum: SAR116_1912Help
Entry
SAR116_1912       CDS       T01207                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01130  Biosynthesis of antibiotics
apb01230  Biosynthesis of amino acids
Module
apb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR116_1912
Enzymes [BR:apb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     SAR116_1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ADE40155
UniProt: D5BMW2
LinkDB All DBs
Position
complement(2111808..2112908)
Genome map
AA seq 366 aa AA seqDB search
MQNLSQLTVGLGDRAYNIVIGPGLLAQAGDILGPIAADRHIVIISDEQVAALHLASLQTS
LTKTARKIDALTVPAGETSKSMSVLARLLDDILALGVDRSVLLIAFGGGVIGDLAGFAAA
SLLRGVDFVQIPTSLLAQVDSSVGGKTGVNAAKGKNLIGAFYQPKAVLADTALLASLPPR
ELCAGFAEVIKYGLLGDRDFFEWLEANGQNVLALDDAAIAHAVYTSCAAKARIVEADERE
AGQRALLNLGHTFAHAFEAEAKYDGRLLHGEAVAAGMGLAFDLSVALNICNGQDAGRCKA
LLEASGLPSGLSNLPAGRASADTLLGHMKHDKKVKDGTMHFVLVRSIGDAFVSGDVPPET
VLALLE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatctctcacagcttacagttggccttggtgaccgcgcttataacatcgtcatc
ggacctgggttgctggcgcaagcaggcgatattctgggcccgattgccgctgaccggcat
attgtcattatcagtgacgaacaggttgccgctttgcatcttgcttcgcttcagacaagc
ctgaccaaaacggcgcgcaaaattgacgctttgaccgtaccagctggcgaaaccagcaag
tcgatgtcggtgctggcgcggttgcttgatgatatactggcgcttggcgtcgatcggtct
gttctgctcattgcttttggtggcggcgtcatcggtgatctggccggctttgcagctgcc
agcctgttgcgcggcgtcgattttgtgcagatcccaacatcgcttctggcacaggtcgat
agctcggttggtggcaaaaccggtgtcaatgcggccaaaggcaaaaatctgatcggtgcg
ttttaccagcctaaagccgtgcttgccgatacggcgcttctggctagcctgccaccacgt
gaactgtgcgccggttttgccgaagtgattaaatatggcttgcttggcgaccgtgacttt
ttcgaatggttagaggccaatggtcaaaatgtgctggcgcttgatgatgcggcgattgcg
catgctgtctatacatcttgcgccgccaaagcgcgtattgtcgaagccgatgaacgcgaa
gctggtcaacgcgccctgctgaatttggggcatacctttgcccacgcctttgaagctgaa
gccaaatatgatggccgattgctccatggcgaggctgttgcggctggtatggggcttgct
tttgacctgtcagttgcgcttaatatttgtaatggacaggatgccggccggtgcaaagcc
ttgctggaagcaagcggattgccaagcggattatcaaatctgccagccggacgtgcatca
gcagacaccctgcttggccatatgaaacatgataaaaaggtcaaagatggcactatgcat
tttgttcttgtaagatcgattggcgatgcttttgtcagtggtgatgtaccgcccgaaacc
gttttagccttattggagtag

DBGET integrated database retrieval system