KEGG   Candidatus Puniceispirillum marinum: SAR116_2331Help
Entry
SAR116_2331       CDS       T01207                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00473  D-Alanine metabolism
apb00550  Peptidoglycan biosynthesis
apb01100  Metabolic pathways
apb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAR116_2331
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAR116_2331
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SAR116_2331
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apb01011]
    SAR116_2331
Enzymes [BR:apb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAR116_2331
Peptidoglycan biosynthesis and degradation proteins [BR:apb01011]
 Precursor biosynthesis
  Amino acid ligase
   SAR116_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 Thymidylat_synt
Motif
Other DBs
NCBI-ProteinID: ADE40574
UniProt: D5BPS2
LinkDB All DBs
Position
complement(2551253..2552161)
Genome map
AA seq 302 aa AA seqDB search
MSAHPSRVAVLMGGWTSEASVSRVSASFCGQAARSAGWDAVEVEVDRDIAEKLAEMKPDR
CFNALHGQVGEDGNIQGLLNIMNIPYTHSGLVASALAMDKVLAKMIMTTCGIRVPATLAL
VEDTHVYPEHAMQAHVIKPLNDGSSFGVVIVKDGDKAPARSLWNTDTQLLCEPFIPGREL
TVAVLEGTALCVTEITSENSFYDFDAKYAPGGSQHILPADIPEDVTLQACEWAESAYRAF
GCRGVIRADYRWNDVTNQLFMLEINTQPGMTATSLVPEQARFVGMTGEELVNHLLETAQC
DD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgcatcctagtcgtgttgccgttcttatgggcggatggacatccgaggcatcg
gtcagtcgtgtttcagcaagcttttgcggacaggcagcgcgttcggctggttgggatgct
gtcgaagtcgaagttgatcgtgatattgccgaaaagctggccgagatgaaacccgaccgt
tgctttaacgccctgcatggacaggttggcgaagacggcaatattcagggtctgctgaac
atcatgaatattccctatacgcatagcggtctggtggcctcggcgctggcaatggataag
gtgctagccaagatgattatgaccacatgtggcatcagggtacccgccaccctagcattg
gttgaagatacccatgtctatccggaacatgccatgcaggcgcatgtgatcaagccactg
aatgacgggtcaagttttggcgttgttattgtcaaggatggtgacaaggcacctgcacga
agtctgtggaatactgatacccagctattatgcgaaccgtttattcccgggcgagaactg
accgttgcggtgcttgagggcacggctttatgcgttaccgaaatcacctctgaaaacagc
ttttatgattttgacgccaaatatgccccgggtggatcacaacatattctgccagctgac
attcccgaagatgtgaccttgcaggcctgtgagtgggctgaaagtgcctatcgggccttt
gggtgtcgcggtgttatccgtgccgattatcgctggaacgatgtaaccaaccagctcttt
atgctggaaatcaatacgcaacctggcatgacagccacttcgctggtgcctgaacaggcg
cgctttgttggcatgactggtgaagaattagtcaatcatcttttggagacagcacaatgc
gacgattaa

DBGET integrated database retrieval system