KEGG   Alpha proteobacterium HIMB59: HIMB59_00002660Help
Entry
HIMB59_00002660   CDS       T02249                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00020  Citrate cycle (TCA cycle)
apc00190  Oxidative phosphorylation
apc00650  Butanoate metabolism
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01120  Microbial metabolism in diverse environments
apc01130  Biosynthesis of antibiotics
apc01200  Carbon metabolism
Module
apc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIMB59_00002660
   00650 Butanoate metabolism
    HIMB59_00002660
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HIMB59_00002660
Enzymes [BR:apc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HIMB59_00002660
    1.3.5.4  fumarate reductase (quinol)
     HIMB59_00002660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer2 Fer4_7 Fer4_9 Fer2_4 Fer4_16 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AFS48469
UniProt: J9YXJ3
LinkDB All DBs
Position
complement(243099..243896)
Genome map
AA seq 265 aa AA seqDB search
MVQLTLPKNSIPVKGKTYSNVELIDDQGQHQADIRIINVYRWSGVEGEPPQIDRFEIDVA
KAGTMVLDILNKIKSEVDTSLTYRKSCREGVCGSCAMNIDGVNTLACQKHIEDCSKEITI
YPLPHMRVVKDLVVDLKKAFEQFKSIKPWLMKNSEHNERENIQSVEDRDKLDGKWECIMC
FSCSTSCPSYWWNEDKYLGPAALLQANRWIQDSRDEEKKERLKELDDNFKLYRCHSIMNC
TRSCPKGLNPAKAISEIKLEIARNK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggtacagctaactcttcctaaaaactctattccagtaaaaggaaaaacatattctaat
gtggaattgattgatgatcagggtcagcatcaagcggatatccgaattattaatgtatat
cggtggtcaggagtagagggagagcctcctcaaatagatcgatttgaaattgatgttgct
aaagcaggtaccatggttctagatattttaaataaaattaaatctgaagttgatacaagt
ttaacataccgtaaatcttgtcgagagggagtttgtggctcttgcgccatgaatatcgat
ggtgttaatacattggcttgccaaaaacatatcgaagactgctctaaggaaattacgata
taccctttaccacatatgagggtagtcaaagacttagtggtagaccttaaaaaagctttt
gagcaatttaaatcgatcaaaccttggttgatgaaaaatagtgaacataacgaaagagaa
aatattcaaagcgtcgaagatcgagataaacttgatggtaaatgggaatgtattatgtgc
ttttcttgtagcacctcctgcccaagctattggtggaatgaagataaatatttaggcccc
gcagcacttttgcaagctaatcgatggattcaagatagtcgtgatgaagaaaaaaaggag
aggctcaaagaattagatgacaattttaaattgtaccgttgccactctattatgaattgt
actcgctcttgccctaaagggttaaaccctgcaaaagcgatctcagagataaaattagaa
atagcgaggaataaataa

DBGET integrated database retrieval system