KEGG   Alpha proteobacterium HIMB59: HIMB59_00002670Help
Entry
HIMB59_00002670   CDS       T02249                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00020  Citrate cycle (TCA cycle)
apc00190  Oxidative phosphorylation
apc00650  Butanoate metabolism
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01120  Microbial metabolism in diverse environments
apc01130  Biosynthesis of antibiotics
apc01200  Carbon metabolism
Module
apc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIMB59_00002670
   00650 Butanoate metabolism
    HIMB59_00002670
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HIMB59_00002670
Enzymes [BR:apc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HIMB59_00002670
    1.3.5.4  fumarate reductase (quinol)
     HIMB59_00002670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_oxidored HI0933_like FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFS48470
UniProt: J9YZP2
LinkDB All DBs
Position
complement(243896..245677)
Genome map
AA seq 593 aa AA seqDB search
MSNYTDHILDVVVLGAGGAGLRAALGCSEQGLKTACVSKVYPTRSHTVAAQGGIGAALGN
MGEDSWQWHMFDTVKGSDWLGDQDSIEYLCSNAVDSIVELEHYGMPFSRTEDGKIYQRPF
GGHMTNNGKGDPASRACAAADRTGHALLHTLYQQSLKNDVQFFNEFYAIDLLKDSSGEIC
GLLALSIEDGSLHRFIAKMTILATGGYGRIFQSSTSAHICTGDGAGIALRAGLPLSDMEF
IQFHPTGIYGVGVLISEAARGEGGVLKNSEGTRFMLEYAPNAKDLAARDVISRFISKEIS
AGRGCGPNKDYINLHLEHLDADMLAKRLPGISESVKAFCGRDVSKEPIPVVPTVHYCMGG
VPTNFKAEVLKPTSDNSEEVCPGLMAIGEAACASVHGANRLGTNALAELVVFGRGAAIQA
GQVINPSESNKMPSDASTQEIIDRLHSIKNNSGDISVGELRDKMQKTVQKRFGVYRESEA
LSLGNQELSDMYKDLKHVKIVDKSDIFNTDLIEALELHNLMEVAGSVGVSAEQRTESRGA
HAREDYPDRDDENWMKHTLAWKDNDQFNITHRPVRMTTLSNQISVIQPQVRVY
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattatactgatcacatattagatgttgttgttcttggagccggaggcgctggc
ttaagagcagccttaggttgctctgaacaaggattaaaaacagcttgcgttagtaaagtt
taccctacacgaagtcacaccgttgctgctcaaggaggcattggtgcagcccttggaaat
atgggcgaggacagctggcagtggcatatgtttgatactgtcaaaggatctgactggtta
ggagatcaagatagtattgagtatctatgctcaaatgccgttgattctattgtcgaatta
gagcattacggcatgcctttttctcgaaccgaagatggaaaaatttatcaaagaccattt
ggtggtcatatgactaacaatggtaaaggagatccggcgagtagagcttgtgcggcggct
gatcgaaccggacatgcgcttcttcacacgctttatcagcaaagccttaaaaatgatgtt
caattttttaacgagttttacgccatcgatcttcttaaagatagtagtggagagatttgt
ggtcttttggccctatccattgaagatggtagtcttcatcgatttatcgcaaagatgacc
attcttgcgactggtggttacggtcgtatttttcaatcctctactagtgcacatatttgt
acgggagatggagcaggcatagctcttagagcaggtcttcctttatcagacatggaattt
attcaatttcatccgacaggcatttatggtgttggggttttaatatcagaggccgctagg
ggtgaaggtggagttttaaaaaatagtgagggcacgcgttttatgttggagtacgcaccc
aacgcaaaagacttagctgcgcgtgatgttatctcaagatttatcagtaaagaaatcagt
gctggccgtggttgcggtccgaataaagattatatcaaccttcatcttgaacatttagat
gccgacatgttagccaaaagattgcccggtatctcagagtcagtaaaagctttttgtgga
cgtgatgtttctaaagagcctattcctgttgtcccaactgttcattattgtatgggcggt
gttcccactaactttaaagcagaagtattaaaacccacttctgataattctgaagaagtc
tgtccaggcttaatggctattggggaggcagcttgtgcttcggttcatggagctaatcgt
ttagggacaaatgctttagcagaacttgtcgtgtttggtcgaggtgcagctatccaggcg
ggccaggttattaatccatcggagtctaataaaatgccgtccgatgcttcgacacaggaa
attatcgatcgacttcactcaattaaaaataattcaggagatatttctgttggagagttg
agagacaaaatgcaaaaaacagttcaaaaaagatttggtgtgtaccgtgaaagtgaagct
ttatcgctaggtaatcaagaattaagcgatatgtataaagatcttaaacacgtcaaaatt
gttgataaatctgatatttttaacactgatttaatcgaggctttagagcttcacaatttg
atggaagttgccggaagtgtcggcgtatccgctgaacaacgcaccgaaagtcgaggcgcc
catgcaagagaggactatcctgatcgagatgatgagaactggatgaagcacacattagcc
tggaaagacaatgatcaatttaatatcactcatcgcccagttcgtatgaccacattaagt
aatcagatttctgttattcaaccccaagtgagagtttattaa

DBGET integrated database retrieval system