KEGG   Anaplasma phagocytophilum Dog2: YYY_05885Help
Entry
YYY_05885         CDS       T02752                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apd  Anaplasma phagocytophilum Dog2
Pathway
apd00010  Glycolysis / Gluconeogenesis
apd00020  Citrate cycle (TCA cycle)
apd00620  Pyruvate metabolism
apd01100  Metabolic pathways
apd01110  Biosynthesis of secondary metabolites
apd01120  Microbial metabolism in diverse environments
apd01130  Biosynthesis of antibiotics
apd01200  Carbon metabolism
Module
apd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YYY_05885
   00020 Citrate cycle (TCA cycle)
    YYY_05885
   00620 Pyruvate metabolism
    YYY_05885
Enzymes [BR:apd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YYY_05885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGR81600
LinkDB All DBs
Position
1330399..1331661
Genome map
AA seq 420 aa AA seqDB search
MPVKVLMPALSPTMKSGTIAKWHKNAGDAVKPGDIVADIETDKAVIEFEYADEPGVMYKI
LKEEGSKNVAVNQSIAVIKVDGDEEAALLEMVHSAEGASGSVSNEAASAALQATPAKVAG
DMVAPSSANKASETAHITSGSDRVKASPLAKKLAAQLSVDISKITGSGPYGRVVKADVLG
ASVPTSDTTIQEGSRVVEVSTMRKVISERLAESKRNIPHFYLAIDCMVGELLEVRSRINS
NAEALGTKITVNDLVIKATALAAREFPEVNALWAGDKIVYHQNVDIAFAVALDDGLLTPV
IAGADKMTLSELSKTAKSLVARAKDRKLLPHEFQGGCLTISNLGMFCIKEFYAIINPPQS
CIMAVGQSEKRPVVVDNCVVAADVMSVTLSVDHRVIDGALAAKFLNRFKFYIENPLAMLA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgaaggtcttaatgcctgccctctcgcctactatgaagagtggtacaatagcg
aagtggcataaaaatgccggagatgcagtaaaacccggggatatagtagcggatattgag
accgacaaagcggtgatagagtttgaatacgcggatgaacctggtgtaatgtacaaaatc
ctcaaagaggaaggtagcaaaaatgtggctgtaaaccagagcattgctgttattaaagta
gatggagatgaggaagcggcgttgctggagatggtgcattctgcggaaggcgcgtcaggt
agtgtttcgaatgaagcggcttcggcagcgttgcaagctacgccagccaaggttgcgggc
gatatggttgctcctagttctgctaacaaggcgagtgaaacagcgcatattacatctggt
agtgatagagttaaggctagtccattggcgaagaagctagctgctcagctgtcagtggat
atcagtaagataactggttctgggccatatggcagagtagtgaaagcggatgtgctgggt
gcttctgtgcccactagtgatacgactatacaagagggtagtcgcgttgttgaagtcagt
accatgcgcaaggttatatctgaacggcttgcagagtcgaagcgcaatataccacacttc
tatctagcaatagattgtatggtgggtgagcttttagaggtacgatctaggatcaatagc
aacgctgaagctttggggaccaaaattactgttaatgaccttgtgataaaggcaactgca
ttagctgcgcgggagtttccggaggttaacgctttatgggcgggagataaaatagtatac
catcagaatgtggatattgcatttgctgtggctttggatgatggtttacttaccccggtt
attgctggtgctgataagatgactttgtctgagctttctaagacggcgaaaagtcttgtt
gcccgtgctaaggaccgtaaactcctgcctcatgagttccaagggggctgtttgacaatc
tcaaaccttggtatgttttgtatcaaggagttttatgcaataataaatcctcctcagtcc
tgtattatggctgttgggcagtctgagaagcgtcctgtggttgtggataattgtgtggtt
gctgcggatgttatgtcagttaccttgtcggtggatcatagggtaatagatggagcgttg
gcagctaagtttttgaacagattcaaattctacattgaaaatccgctggctatgctggct
tag

DBGET integrated database retrieval system