KEGG   Acetobacter persici: A0U91_01845Help
Entry
A0U91_01845       CDS       T04751                                 

Definition
(GenBank) thiol reductant ABC exporter subunit CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
aper  Acetobacter persici
Pathway
aper02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aper00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A0U91_01845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aper02000]
    A0U91_01845
Transporters [BR:aper02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    A0U91_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_16 SMC_N ABC_membrane AAA_21 IstB_IS21 RsgA_GTPase AAA_22 AAA_24 DUF87 AAA_29 AAA_33 MMR_HSR1 Roc AAA_5
Motif
Other DBs
NCBI-ProteinID: AQT03964
UniProt: A0A1U9LBZ3
LinkDB All DBs
Position
414832..416526
Genome map
AA seq 564 aa AA seqDB search
MNISDQKEASTPALTDCQAVLRILGLWRRQAPRLIIGVMLALIALCLGLVLMQASGLRLA
SSVLGEVVITTALLRWVGGGRVVLRYAERLFAHDAMFRALADLRVWFFHSLAQGAAAGLG
FRRAGDMLSRLVSDIGTLDGLYLRIFVPFACACLTLPILVVQLGRQSIVLGVAVGLLFAC
SAFGVPYLIARSGRAEGERLGKNLAALRIGVLDLVGGLREIRAFGAEGRILSHVQADDAA
LLAGQMRLARRAAYANASAFLCGQAAIFLVLLAAAGVFALHLSPLAVVGSLFLTVASFES
AATLTRAGLQAGVMGAAAQRVVEVAAHTPDSKQSKAQTEAPAGTDIRLDGVKFRWAPDRP
LVFDGLTLDIPAGARVAILGPSGVGKSSLAALLLKAATPEAGNITLGGEDISHIRADSLR
QRMAWLSQATHLFDDSIRANLLLGRPDATEDDLWKALEDAAVADVVKTLPDGLDTWLGEG
GIKLSGGQGRRIALARTLLTQAPILILDEPATGLDAQTEQEFLRTLNTVTEGRTVILIAH
RLTGVETLDRIWRLSGGVATAAAA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaacatatccgaccagaaagaagccagcacgcccgctctgactgattgtcaggccgtt
ctgcgtattctgggcctctggcgcagacaggctccacggctaattattggcgtcatgctt
gctctgattgccctatgtctgggccttgtactgatgcaggcttcagggctccgtctggcc
agcagcgttctgggtgaggtggtgatcaccactgctctgttgcgctgggtcggcggtggc
cgggttgttctgcgctatgcagaacggctttttgcgcatgatgccatgttccgtgcgctg
gcggacctgagggtctggtttttccattctctggcacagggggcggccgcgggtctcggg
ttccggcgggcaggcgatatgctctcacgccttgtgtcggacattggtacgctggatggg
ctgtatctgcgtattttcgttccctttgcctgtgcgtgcctgacgctgcccattctggtc
gttcaactgggccgccagagtattgtgctgggcgtggcggttggcctgctctttgcctgt
tcggcgtttggggtgccttacctgattgcccgctccggccgggcagaaggggagcgtctg
gggaaaaacctcgcggccctgcgtattggcgtgctggatctggttggtggtttgcgggaa
atacgcgcttttggtgcggaagggcgtattctctcgcatgtgcaggctgatgacgccgct
ctgctcgctggccagatgcggcttgcgcgacgggccgcatatgccaacgcctccgctttt
ctgtgtgggcaggcagcaatctttctggtgcttcttgctgctgccggtgtgtttgctctc
catctttccccgctggccgtagtcggcagcctcttcctgacggttgcgtcttttgagagt
gccgcaacactgacacgggcaggcttgcaggcaggcgtgatgggggctgcggcgcagcgc
gtcgtggaagttgcagcccataccccggacagcaaacagagcaaggcgcagactgaggct
ccggccggaaccgacattcgtcttgacggtgtaaagttccgctgggctcccgatcgtccg
ctcgtgtttgatgggttaacgctggatattcccgcaggcgcgcgtgtcgccatccttggc
ccgtcaggggttggcaaatccagccttgcggctctcctgctcaaggctgccacgccggaa
gcgggcaatatcacgcttggcggagaagacatttcccatatccgcgcggactccctgcgg
cagcgcatggcgtggttatctcaggccacacatctgtttgacgacagcatccgggccaat
ctgcttcttggtcgtcccgacgcgacagaagatgatctgtggaaagcacttgaagacgct
gctgtagcggacgtggtgaagacgctcccggacgggctggacacgtggcttggtgaaggc
ggcatcaagctgtctggcgggcaggggcgacgcatcgcactcgcccgtacacttctgacg
caggctccgattctgattctggacgagccagccaccgggctggatgcgcagacagagcag
gagttccttcgtacgctcaataccgtcacagaaggccgcactgtcattctgatcgcgcac
cggctgaccggcgtggaaactctggaccggatctggcgtctttcgggcggtgttgcgacg
gccgctgccgcctga

DBGET integrated database retrieval system