KEGG   Acetobacter persici: A0U91_02045Help
Entry
A0U91_02045       CDS       T04751                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aper  Acetobacter persici
Pathway
aper00010  Glycolysis / Gluconeogenesis
aper00020  Citrate cycle (TCA cycle)
aper00620  Pyruvate metabolism
aper01100  Metabolic pathways
aper01110  Biosynthesis of secondary metabolites
aper01120  Microbial metabolism in diverse environments
aper01130  Biosynthesis of antibiotics
aper01200  Carbon metabolism
Module
aper_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0U91_02045
   00020 Citrate cycle (TCA cycle)
    A0U91_02045
   00620 Pyruvate metabolism
    A0U91_02045
Enzymes [BR:aper01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A0U91_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AQT03994
UniProt: A0A1U9LC24
LinkDB All DBs
Position
461124..462395
Genome map
AA seq 423 aa AA seqDB search
MAIEVLMPALSPTMTEGALARWVKAEGDKVTIGDVIAEIETDKATMEVEAVEDGILGRIL
VPEGTQEIAVNTPIALLIAEGEAVPEAGPVSRQAPAASALQKAEQPVATQQKSASAAVPA
QTTSSVQPAAGKRIIASPLAKRIAGQKGVDLSTIKGSGPNGRIVRRDVDSAAAHGKPVTS
ATGQGAAIAPSSSSRSVPHSGMRKVIARRLTEAKSTIPHFYVSVDVELDALLALRSQLNA
TSPEEGPDAFKLSVNDMLVKASAIALKRVPNVNASFTDQAMILHDNVDISIAVSIPDGLI
TPIVTHVEQKSLKQISQETKDLVKRARAGKLKPEEFQGGTFSISNMGMFGVRDFSAIINP
PQAAILAIAAAKKQPVVKGNELAIATVMTVTLSVDHRVVDGAVAAEWLSAFRSVVESPLT
LVL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaagttctgatgccggccctttcccccaccatgacggaaggcgcgctggcc
cgctgggttaaagcggaaggcgataaggttacgattggcgatgtgattgccgaaatcgaa
accgataaggcgaccatggaagtagaagccgtcgaagacggaattctcggccgtattctt
gtgccggaaggcacgcaggagattgcggtgaatacacccatcgcactgctgattgctgag
ggcgaagctgtgccggaagcaggaccggtcagccgacaagctccggcggcctcagccctg
cagaaggcagaacaacccgtcgcaactcagcagaagtctgcatccgctgctgttcccgcc
cagacgacatcgtccgttcagcctgccgcggggaaacggattattgcgtctcctctggca
aagcgtattgcgggccagaaaggggtggatctttccaccattaaaggttccggcccgaat
ggccgtattgtccgccgggatgttgatagcgccgcggctcatggaaagccggttacgtcg
gccaccgggcagggggctgccatcgcgccgtcttcctccagtcgctctgtgccgcattcc
gggatgcggaaagtcattgcgcgccgcctgactgaagcaaaaagcacaattccgcatttt
tatgtctccgttgatgtagaactggatgcgctgcttgctctgcgctctcagctgaacgca
acctctccggaagaggggccggatgctttcaagctgtccgtgaatgacatgctggtcaaa
gcctcggcgattgcgctcaagcgggtgccaaacgtgaatgcgtctttcacggatcaggct
atgatcctgcatgataatgtggatatttctatcgccgtctccattccggacgggctgatt
acccccattgtgacgcatgttgagcagaaaagcctgaagcagatcagtcaggaaaccaaa
gatctggtgaagcgcgcccgcgcaggcaaactgaagcccgaagagtttcagggcggcacg
ttctccatctccaatatggggatgttcggcgtgcgtgatttctctgccatcatcaacccg
ccgcaggccgctattctggccattgcagccgcaaaaaagcagcctgtggtgaaggggaat
gaactggcgattgcaaccgtgatgacggtcactctctccgttgatcatcgcgttgtggat
ggtgcggttgcggcggaatggctttcagctttccggtcggtggtcgaatctcctctgaca
cttgttctttaa

DBGET integrated database retrieval system