KEGG   Acetobacter persici: A0U91_04265Help
Entry
A0U91_04265       CDS       T04751                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aper  Acetobacter persici
Pathway
aper00020  Citrate cycle (TCA cycle)
aper00310  Lysine degradation
aper00380  Tryptophan metabolism
aper01100  Metabolic pathways
aper01110  Biosynthesis of secondary metabolites
aper01120  Microbial metabolism in diverse environments
aper01130  Biosynthesis of antibiotics
aper01200  Carbon metabolism
Module
aper_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aper_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0U91_04265 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    A0U91_04265 (sucA)
   00380 Tryptophan metabolism
    A0U91_04265 (sucA)
Enzymes [BR:aper01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A0U91_04265 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II COQ9
Motif
Other DBs
NCBI-ProteinID: AQT04331
UniProt: A0A1U9LD19
LinkDB All DBs
Position
complement(939848..942742)
Genome map
AA seq 964 aa AA seqDB search
MAASDVLTTALNGANIAYLADLYARWAQDPKSVDPSFDTLFGSLDDDEAAVLKDAVGASW
APRPSIITGEEPAAPAKGGAGSAAGGLAATDSLAIARLIRAFRVYGHQEARLDPLGLRVP
HATPELDPATYGFAQKDLGREVYIGSLMAPLLKGRTTAKVSEVVDALRAVYCDTIGAEYV
HARNAEQRDWLRNRLEGDQWRQTVTVDEQKAILKNLTEAEGFESFCQKRYVGAKRFGLEG
GEISIPSLHAIIDQAAAQGVTSVTIGMAHRGRLNTLVNVVRKPYVAIFNEFAGGSFKPDD
VAGSGDVKYHLGSSTDVEVGGKSVHISLQPNPSHLEAVDPVVCGKVRAIQDDSGDTETRG
SHMGIVIHGDAAFAGQGVVYETLSMSQLPGYRTGGTIHMVVNNQVGFTTDPKNGHSGIYG
TDVAKAIEAPVLHVNGDDAEAVIYVSRLAQDYRQAFASDIVLDIVCYRRHGHNETDEPAF
TQPVMYKAIAEHETPHTLYAKRLVQAGVVTDEDVKSQWDAFFLKLDEDYKAAQSYKVNKA
DWLEGGWAGLIAPTTGKVESAYPETGVAVETLQKIGSAITQVPGDFDLNSKIARQLKAKA
GMFSSGEGFDWATGEALGFGSLLLEKHRVRLSGEDCQRGTFSQRHATLIDQTNQTPFTPL
NHIDGEQAKIEIWNSFLSEYGVLGFEYGYSLRNPKTLVLWEAQFGDFANCAQVIIDQFIA
SGETKWLRMSGLVMLLPHGYEGQGPEHSSARLERYLQLCAEDNMFVCNITTPANYFHALR
RQLKLDYRKPLIVMEPKSLLRHKLAISALSDFGPGKRFQPVLADVNDPQDDGLVADAQIR
RVVICSGKVYYDLLAARRENTLKDVAILRLEQLYPFPEAALAAELKRYPEAEVIWCQEET
ENGGAWHFVDRRIENALQAAQHKAGRPRYVGRAAAASPATGLARIHAAEQANLVERALGL
KKTD
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcagacgtgctgacaaccgcgctcaacggagcaaatatcgcgtatctggcg
gacctgtatgcccgctgggcgcaggaccccaaaagcgttgacccctcattcgatacgctt
tttggctctctggatgatgatgaagccgcagtgctgaaagacgccgtgggggcctcatgg
gcgccacgcccgtccatcatcacgggggaagagcctgctgctccggccaaaggcggagca
ggcagtgccgcaggcggactggccgccacggacagtctggctattgcccggctgatccgc
gccttccgcgtttacgggcatcaggaagcccggctggacccgctgggcctgcgcgtgccg
cacgccacaccggaactggaccccgcgacctacggtttcgcgcagaaagatctgggccgc
gaagtctatatcggttccctcatggctccgctgctgaaaggccgcaccacggccaaagtc
agtgaagtggtggacgcactccgggccgtctattgcgacacaatcggcgcggaatatgtg
catgcccgcaatgccgaacagcgcgactggctccgcaaccgtctggaaggcgaccagtgg
cgccagaccgtgacggtggatgagcagaaagccatcctgaaaaacctgacggaagccgaa
ggttttgaatctttctgccagaaacgctacgtcggcgcgaagcgctttggccttgagggc
ggggaaatttccattccctccctgcatgccattattgatcaggccgccgcacagggcgtg
acctcagtcaccatcggcatggcgcatcgcgggcgtctgaacacgctggtgaacgtggtc
cgcaaaccctatgtggcgatctttaatgaatttgccggtgggtctttcaaaccggatgat
gtggcgggttcaggggatgtgaaataccatctcggctcctccacggatgtggaagtgggc
ggcaagtccgtccatatctccctgcaacccaacccgtcccatctggaagcagtggaccct
gtggtgtgcggcaaggtgcgcgccattcaggatgatagcggggatacggaaacccgcggg
agccatatgggcattgtcatccacggggatgctgcctttgccgggcagggggtggtgtat
gaaacactttccatgtcccagcttcccggttaccgcacgggcggcaccatccatatggtg
gtgaacaatcaggtcggcttcacgacggacccgaaaaacggccattccggcatttacggc
acggacgttgccaaagcgattgaagcgccggtcctgcatgtcaacggtgatgatgccgag
gcggtgatttacgtctctcgtctggcgcaggattaccggcaggcttttgccagtgacatc
gtgctggatatcgtctgctaccgtcgccacgggcacaatgaaacagatgaacccgccttc
acgcagccggtgatgtataaagccattgctgagcatgaaacgccgcatacgctttatgca
aaacgccttgtgcaggctggcgttgtgacagatgaggatgtgaagagccagtgggatgcc
ttcttcctgaaactggatgaagactacaaggctgcacaatcctataaggtgaataaagcg
gactggcttgaaggcggctgggccgggctgattgcccccacaaccggtaaagtggaatct
gcttatccggaaacgggtgtggcggttgaaacgctccagaaaatcggttctgccatcacg
caggttccgggtgattttgacctcaattccaaaatcgcacgtcagcttaaagcaaaagcc
ggaatgttctcctccggggaagggtttgactgggctacgggtgaggctctgggctttggc
tctctgctgctggaaaaacaccgtgtgcgtctgtctggtgaagattgccagcgcggcacg
ttcagccagcgtcatgcaacactgatcgaccagaccaaccagacccccttcacaccgctg
aaccatattgacggtgagcaggccaaaattgaaatctggaactcattcctttcagaatat
ggcgtgctgggttttgaatatggctactccctgcgcaaccccaaaacgctggtgctgtgg
gaagcgcagtttggtgactttgccaactgcgcacaggtgattatcgaccagtttattgcc
tcgggtgaaaccaaatggctgcgtatgtccggtctggtcatgctgctgccgcatgggtac
gaagggcaggggccggaacattcttccgcacggcttgagcggtacctccagctttgcgct
gaagacaatatgtttgtgtgcaacattacaaccccggccaactacttccatgcgctgcgc
cgccagttgaagctggattaccgtaaacccctgattgtgatggagccgaaatctctgctc
cgccacaagctggccatttccgccctgtccgacttcgggccggggaaacgcttccagccg
gtgctggcggatgtgaatgacccgcaggacgatggtctggtggctgatgcgcagatcagg
cgcgtcgtgatctgctctggcaaggtctattatgatctgctggccgcacgccgggaaaac
acgttgaaggacgttgccatcctgcgtctggaacaactctacccgttcccggaagcagcc
ctcgccgccgagctgaagcgttatcctgaagccgaggtgatctggtgccaggaagaaacg
gaaaatggcggggcgtggcattttgttgatcgccggattgaaaatgcgcttcaggccgcg
cagcataaggcgggccgccctcgttatgtgggccgtgccgcggctgccagcccggcaaca
ggtctggcgcgcatccatgcggcagagcaggcgaaccttgtggaaagggccttgggtttg
aagaaaacggactga

DBGET integrated database retrieval system