KEGG   Acetobacter persici: A0U91_08260Help
Entry
A0U91_08260       CDS       T04751                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
aper  Acetobacter persici
Pathway
aper00330  Arginine and proline metabolism
aper01100  Metabolic pathways
aper01110  Biosynthesis of secondary metabolites
aper01130  Biosynthesis of antibiotics
aper01230  Biosynthesis of amino acids
Module
aper_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aper00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    A0U91_08260
Enzymes [BR:aper01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     A0U91_08260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored GFO_IDH_MocA ApbA
Motif
Other DBs
NCBI-ProteinID: AQT04915
UniProt: A0A1U9LEM6
LinkDB All DBs
Position
1831051..1831875
Genome map
AA seq 274 aa AA seqDB search
MTTPTSPLPSVLLVGCGQMGGAMLEGWMAHGLKPSVVLDRHDRTLPAPHHLAATLEDVPT
DFQPDVIILAVKPQKADPTLEALARRFPSATLLSVMAGRTVQSLTDRYQHGNPQAQPVII
RAMPNTPCAIGAGMSGLYAPPHATDTQKAQCDALLHAVGETVWVEREDLIDSVTAISGSG
PAYIFLLAELLEKAGVEQGLPVETARTLARKTIYGAGALLNQSPAEAEELRRRVTSPGGT
TAEALKIFMAPDAWPAIVPRAVAAAARRAKELST
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccccaacctctcccctgccgtctgttctgctggttggctgcggccagatgggc
ggtgccatgctggaaggctggatggcgcacggcctgaaaccctccgtcgtgctggaccgg
catgaccgcaccctgcccgctccccatcatctggccgctacgctggaggatgttccgacc
gactttcagccagacgtcattattctggccgtcaaaccccagaaagccgacccaacgctg
gaagctctggcccggcgcttccccagcgcgacgctgctctcagttatggcaggccgcacg
gtgcagagcctgacggaccgctaccagcacggaaaccctcaggcgcagccggttattatc
cgcgccatgcccaacaccccctgtgctattggtgccggcatgagcggactgtatgcgccc
cctcacgcgactgacacgcagaaagcgcagtgtgacgcactgctgcacgctgtgggggaa
acagtctgggttgagcgggaagatctgattgactccgtcaccgccatttccggcagtggc
ccggcttatatcttcctgctggcggaactgctggaaaaggctggtgtggaacaggggctt
cccgttgaaacggcccgcacactggcccggaaaaccatttacggcgcgggagctctgctc
aaccagtctccggcggaggctgaggaactgcgccgccgcgtgaccagccccggcgggacc
acggcagaagcccttaaaatcttcatggctcctgacgcatggcctgccattgtgccgcgt
gccgttgcggctgcggcaagacgcgccaaagagctttcaacctga

DBGET integrated database retrieval system