KEGG   Acetobacter persici: A0U91_08935Help
Entry
A0U91_08935       CDS       T04751                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
aper  Acetobacter persici
Pathway
aper00220  Arginine biosynthesis
aper01100  Metabolic pathways
aper01110  Biosynthesis of secondary metabolites
aper01130  Biosynthesis of antibiotics
aper01210  2-Oxocarboxylic acid metabolism
aper01230  Biosynthesis of amino acids
Module
aper_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:aper00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A0U91_08935
Enzymes [BR:aper01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     A0U91_08935
    2.3.1.35  glutamate N-acetyltransferase
     A0U91_08935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AQT06083
UniProt: A0A1U9LI04
LinkDB All DBs
Position
complement(1982585..1983829)
Genome map
AA seq 414 aa AA seqDB search
MAHALPVSPLALPLPELKEVRGVRLGAAEAGIRYKGRTDLVLAEFVPGTTVAGVFTRSKC
PGAPVDWCRDILPTGEARALVVNAGNANVFTGRAGRETCKATAEATALLAGCTPQAVYLA
STGVIGEILPHERMTAALPALHEALSATGWEAAARGIMTTDTFPKAAVRTAKLNGTDVLI
QGIAKGSGMVAPDMATMLAFVATDAALPAPVLQALLSQGVKATFNCITVDSDTSTSDMVL
LFATGAAGNDELSASTQANAEALTDFREALQGVLHDLAQLVIRDGEGATKLMTISVTGAV
SDDSAWRIAMAIGNSPLVKTAVAGEDANWGRIVMAVGKCGEPADRDTLSVSIGGVCIARD
GTVVPGYDETPVVAHMKGHEIDIAVDLGLGSGTARAWSCDLTHGYIDINGSYRS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgctcttcccgtctcccccctcgctctgcctctcccggaactgaaggaggtg
cgcggggtgcgtcttggcgcggcggaagccggtattcgttacaaaggccggactgacctc
gttctggccgaatttgtacccggcaccacggtggccggtgtttttacccgctccaaatgc
cccggtgccccggttgactggtgccgcgatattctccccacgggggaagcccgcgccctt
gtggtcaatgccgggaacgccaacgtctttaccggccgggcagggcgtgaaacctgtaaa
gccacagccgaggccacggctctgctggcgggctgcaccccgcaggccgtctatctggcc
tccaccggcgtcattggggaaattctgccgcatgagcgcatgacggcggccctcccggcc
ctgcatgaggctctgtcggccacagggtgggaagccgcagcccgtggcatcatgacgacg
gacaccttccccaaagcggccgtccgcacagcaaaacttaatggcacggatgttcttatt
cagggcattgccaaaggcagcggcatggtcgcaccggacatggccaccatgctggctttt
gttgcgaccgatgccgccctcccggccccggtgctacaggccctgctctctcagggtgtt
aaggcaaccttcaactgcatcacggttgattcagacacctccacctcggatatggtgctg
ctgtttgccaccggcgccgccgggaatgatgaattgtccgccagcacacaggccaatgcg
gaagccctgacggacttccgcgaggccctgcagggcgtgctgcatgatctggcccagctt
gtaatccgggacggagaaggcgccaccaagctcatgaccatcagcgtgaccggtgccgtc
tcggacgactccgcatggcgcatcgctatggcgatcgggaattccccgctggtgaaaacc
gccgtcgcgggggaagacgccaactggggccgcattgtcatggccgttggtaaatgcggg
gaacctgcggaccgggacacgctctccgtttccatcggcggcgtctgcattgcgcgtgac
ggcacggttgtgcccggctatgatgaaacaccggttgtcgcccacatgaagggccatgag
atcgacatcgctgtggatcttggccttgggagcggcaccgcccgtgcgtggagctgtgac
ctgacccacggttacatcgatatcaacggatcctaccggagctga

DBGET integrated database retrieval system