KEGG   Acetobacter persici: A0U91_12545Help
Entry
A0U91_12545       CDS       T04751                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aper  Acetobacter persici
Pathway
aper00473  D-Alanine metabolism
aper00550  Peptidoglycan biosynthesis
aper01100  Metabolic pathways
aper01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aper00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0U91_12545
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0U91_12545
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A0U91_12545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aper01011]
    A0U91_12545
Enzymes [BR:aper01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A0U91_12545
Peptidoglycan biosynthesis and degradation proteins [BR:aper01011]
 Precursor biosynthesis
  Amino acid ligase
   A0U91_12545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AQT05542
UniProt: A0A1U9LGK8
LinkDB All DBs
Position
complement(2798572..2799513)
Genome map
AA seq 313 aa AA seqDB search
MSNSKRITVLMGGMSSERDVSLSSAKGVVEALRSLGHTVTTLDAGADLAALVTALAEQKP
DVVFNALHGQFGEDGCIQGVLDWLGIPYTHSGVRASATAMDKAAARAVFLSAGLPVAEGK
VIAIDDLAEADPMPAPYVVKPVSEGSSVGVSIVRAGSNTRHEIIKNWRYGPHALVEDFIP
GKEITVGVLGDRALTVTDITPTPGAGRDFYDYDAKYTSGGSSHVLPADIDDAVSKQACAV
AVAAHQALGCSGASRSDFRLDDTGPGPARLILLEVNTQPGMTATSLLPEQAAYCGISYPE
LCGWLVDQATCRQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagcaaacggattaccgttctgatgggcggcatgtcttccgaacgggatgtc
agcctctcttccgccaaaggtgttgttgaggccttgcgcagccttggccataccgtaacc
acgctggacgccggggctgatctggcggcactggttacggcccttgccgagcagaaaccg
gacgtcgtgttcaacgccctgcacgggcaattcggggaagatggctgtattcagggcgtg
ctggactggcttggcatcccctacacccattccggcgtgcgggcttctgccactgccatg
gacaaagccgcagcccgcgctgtttttctctccgccggtctgccggttgcagaaggtaag
gtgattgccattgatgatctggctgaagccgaccccatgcccgccccctatgtcgtcaaa
ccggtaagcgagggctcctccgttggcgtgtccatcgtgcgcgccgggtccaacacgcgg
catgaaattattaaaaactggcgctacggcccccatgctctggtggaagattttatcccc
ggcaaggaaattacggtcggtgtgctgggagaccgtgccctgaccgttacggacattacg
cccacccccggcgcgggccgtgatttttatgattatgacgcaaaatataccagtggcggc
tccagccatgtcctgcctgcggacattgatgatgctgtgagcaaacaggcctgtgccgtt
gctgttgccgcgcatcaggcgcttggctgctccggcgcatcccgctcggacttccggctg
gatgataccggccccggcccggcccggctgatcctgcttgaagtcaacacccagccggga
atgacggcaacctccctgctgccggaacaggctgcctattgtggcatcagctacccggaa
ctgtgtggctggctggttgatcaggcgacctgccgccaatga

DBGET integrated database retrieval system