KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_09310Help
Entry
APA03_09310       CDS       T01812                                 

Definition
(GenBank) translation elongation factor Tu (EF-TU)
  KO
K02358  elongation factor Tu
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Brite
KEGG Orthology (KO) [BR:apf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:apf03012]
    APA03_09310
   03029 Mitochondrial biogenesis [BR:apf03029]
    APA03_09310
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:apf04147]
    APA03_09310
Translation factors [BR:apf03012]
 Eukaryotic Type
  Elongation factors
   APA03_09310
 Prokaryotic Type
   APA03_09310
Mitochondrial biogenesis [BR:apf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    APA03_09310
Exosome [BR:apf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   APA03_09310
  Exosomal proteins of breast cancer cells
   APA03_09310
  Exosomal proteins of colorectal cancer cells
   APA03_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAI02129
LinkDB All DBs
Position
974585..975775
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKTLAKKGGAEFKAYDQIDAAPEERARG
ITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSSYQFPGDDVPIIKGSALVTLE
DGDPEIGENRVRDLMDAVDSYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVIN
VGDEIEIVGLKPTTKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHKKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNCA
MEVELIAPIAMDEGLRFAIREGGRTVGAGVVSSIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaaatttgagcggaataaaccgcactgcaacatcggcaccattggtcac
gttgaccatggcaagacctctctgacggcagcgatcaccaagacgcttgcaaagaagggt
ggcgctgaattcaaggcgtatgaccagatcgacgctgctccggaagaacgcgctcgcggt
atcaccatttccacagcacacgtggaatatgaaaccgacaaccgtcactatgcgcacgtt
gactgccccggacatgctgactacgtgaagaacatgatcacgggtgcagcgcagatggac
ggcgcaatcctggttgtgtccgcagctgacggcccgatgccgcagacccgtgaacacatc
ctgcttgctcgtcaggttggtgtgcctgctctggttgtcttcctgaacaaggttgaccag
gttgacgatccggaactgcttgaactggttgaaatggaagttcgtgaacttctgtcttcc
tatcagttccctggcgacgatgtgccgatcatcaagggttccgctctggtaactctggaa
gatggtgatccggaaatcggtgaaaaccgtgttcgcgatctgatggacgcagttgactcc
tacatcccgcagccggaacgtccggttgaccgtccgttcctgatgccgatcgaagatgtg
ttctccatctctggtcgtggcaccgtggtaacgggtcgtgtagaacgcggcgtgatcaat
gttggtgacgaaatcgaaatcgttggtctgaagccgacgacgaagacaaccgtaaccggc
gttgaaatgttccgtaagctgcttgatcgcggtgaagctggtgacaacatcggcgctctg
ctgcgtggcacgaagcgtgaagatgtggaacgtggtcaggttctggcaaagccaggctcc
atcacgccgcataagaagttcaaggcagaagcttacatcctgacgaaggaagaaggtggc
cgtcatacgccattcttcaccaactatcgtccgcagttctatttccgtacgactgacgtg
acgggtgttgtgcacctgccagaaggcaccgaaatggtgatgccgggcgacaactgcgct
atggaagtcgagctgattgctccgatcgccatggacgaaggtctgcgtttcgctattcgc
gaaggtggccgcacggttggtgctggcgttgtttcctccattatcgagtaa

DBGET integrated database retrieval system