KEGG   Acetobacter pasteurianus IFO 3283-12: APA12_16650Help
Entry
APA12_16650       CDS       T01814                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
apg  Acetobacter pasteurianus IFO 3283-12
Pathway
apg00620  Pyruvate metabolism
apg00680  Methane metabolism
apg01100  Metabolic pathways
apg01120  Microbial metabolism in diverse environments
apg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APA12_16650
  09102 Energy metabolism
   00680 Methane metabolism
    APA12_16650
Enzymes [BR:apg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APA12_16650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAI21066
LinkDB All DBs
Position
1799485..1802283
Genome map
AA seq 932 aa AA seqDB search
MTMDNTSSPSRLDSILASATAHPDAGTAAEGTNPVMGIALRLGEALSREEISQTDITSLV
QKLRDEAFLARARKLHRYVGGATTEATKEKFRNVARAIAEACPTGSFAEYQAHISAIQFA
AVFTAHPTFALSNPVYAALAESASQAIPPQEAPFFETHRRAAPPTLEEEFTLAAQAITRA
RDAMDLLATALLEEAATRWPQEWTSLKPCPVIATSWVGYDTDGRTDIGWWDTLRLRLRMK
LFQLMRLESQIMHEGLLAPELTEKLQRAIACVKEQISAVPAGPSDAQAVAHFAKLLVSQR
NTALTHAAELEGLLETAINSAPPSARIPLAVARAGFLAHGLGLAHTHVRLNASQIHNFVR
QKLNLLDDPNNPAHRRALLNQINEALESVTPVPVDFGALLSDPSSAGRLMMTIAQMVKFI
DSDTPVRFLIAETETGYTLLSALWVASCFGVADKIEISPLFETEDALMNGEHIVEEALRS
PAWRAYIRRIGRICFQFGYSDSGRYVGQLAATYLIERLRLRIHDLLVRWDMQDITVVFFD
THGESIGRGAHPFRMADRLDYLSPPHVRARFKTTGIACREETAFQGGDGYLLFGTPELAG
ATLATIAENLFLPLRQEEDPIYDQPDFSADFFSSISEGMKKLVEDPGYAALLGAFGPSLI
DRTGSRPPARQSAESATHKRITHPSQLRAIPNNAILQQLGWCANTLQGLGAAVRRHPETF
ETFRTSSPRFHRALDFAQHGLTCSDDKVLKSVVCLLDPGFWLDRATEEKTPARRKAFLSL
MQDLEKLDLSAELLTMFRRIQADHLALREAWEHAPRTEPQIRLLHAIRIMLIEQIWLLAC
RVPFFMPRGGFNHDVMMQHILCLDIPAVLEELEHIFPTGTGPTNLDFHEPRGPREEGIYE
REHRDIFVPMQRMFELIREISVAIMHNIGAFG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgactatggataacacatcttctccttcccgtttggacagtatccttgcgtccgctact
gcgcacccagatgctggcacagcagctgaaggcacaaatcctgtaatgggcattgcgctc
cgacttggagaagctttgagccgcgaggaaatctcacaaacagatattacaagccttgtg
caaaagctgcgcgatgaagcctttctggcgcgcgcccgtaagctgcatcgctacgtaggt
ggcgcgacaacggaagccactaaagagaagttccgcaatgttgcacgtgcgatagccgaa
gcatgccctactggctcttttgcagagtatcaggcacacatctctgccattcagtttgct
gcggtctttactgcgcaccccacgtttgccctgagcaaccctgtgtatgcggctttggca
gaaagtgcatctcaagccattcccccgcaggaagcaccgttttttgaaacgcacagacgc
gctgccccacccacgctggaagaagaatttacactggccgcgcaagccataacccgtgcg
cgggatgccatggatctgctggctactgccctgctggaagaagcggccacacgttggccg
caggaatggacaagcctgaagccctgcccggttattgcaaccagttgggttggctatgat
accgatggccgcactgatattggctggtgggacaccctgcgcctgcgcttgcgcatgaag
ctgttccaactgatgcggttggaaagccagatcatgcacgagggcttgctggccccagaa
ctaacagaaaagctgcagcgggctattgcctgcgtaaaagaacagattagcgctgttcct
gctggcccaagtgatgcccaggctgtagcccattttgcaaaacttctggtttctcagcgc
aacacagcgctcacacacgcagcagaattggagggcttgcttgaaaccgccatcaatagc
gcgccaccctctgcccgcattccactggctgttgcccgggcaggttttctggcgcatggg
ctggggcttgcgcatacgcatgtgcgacttaatgcctcccagatacacaacttcgttcgc
cagaagctgaacctgctggatgaccccaacaacccggcacatcgtcgggcattgttgaac
cagattaacgaagcgctggaatctgtaacacctgttcctgtggactttggcgcgctgctg
agcgacccctccagtgctggacggctgatgatgaccattgcgcaaatggtcaaatttatc
gattccgatacacctgttcgtttcctgattgcagaaacagaaaccggttacacattgctc
tcggccctgtgggtggcctcctgctttggtgtggcggataaaattgaaatctcgccgctg
tttgaaacggaagatgcgctcatgaacggtgagcacattgtggaagaagccctgcgctct
cccgcatggcgtgcctatatccgccgtattggccgtatctgcttccagtttggatattcc
gattctggccgatatgttggccagttggcggcaacgtatctgatagagcgcctgcgcctg
cgtattcatgatctgctggtgcggtgggacatgcaggatatcaccgtggtgttttttgat
acgcacggtgaaagcattggtcgcggcgcgcaccccttccgtatggcggatcggctggat
tacctttctccgccgcatgtgcgtgcacggtttaaaaccaccggcattgcctgccgtgag
gaaacggcttttcagggtggagatggctacctgctttttggcacgccagaactggcgggc
gctacgttggccaccattgcggaaaacctatttctgcccttacggcaggaagaagacccc
atttatgatcagcctgatttttcggctgatttcttctccagcattagcgagggcatgaaa
aaactggtggaagaccccggttatgctgcgcttctgggcgcttttgggccatcccttatt
gatagaaccggctctcgtccccctgctcggcagagtgcagaaagcgccacccacaagcgc
attacccaccccagccagctacgcgccatccctaacaacgcaattcttcagcagctcgga
tggtgcgccaacaccttgcagggcttgggggcagccgtacgccgccacccggaaaccttt
gaaacattccgcacatccagcccgcgctttcatcgtgctctggattttgcccagcatggc
ctgacctgctcggatgataaggtgctgaaaagcgttgtctgtttgctagaccccggcttc
tggctcgaccgcgccacagaggaaaaaacgccagcacgccggaaggcttttctctccctg
atgcaggatctggaaaagcttgatctgtctgccgaactgctcaccatgttccgccgtatt
caggctgaccatcttgcgttgagagaagcgtgggaacatgcaccgcgcacggaaccacag
atccggcttctgcacgccattcgtattatgcttattgagcagatatggctgctggcatgc
cgtgtacccttcttcatgccacgtggcggctttaaccatgatgtcatgatgcagcacata
ctgtgtctggatattccggcagtgttggaagagcttgagcatatcttccccaccggcacg
ggcccaaccaaccttgattttcatgaaccacgtggcccgcgcgaagaaggtatttacgag
cgagagcacagagacatctttgtacccatgcaacggatgtttgaacttattcgtgaaatc
agcgtcgccatcatgcacaatattggcgcttttggctga

DBGET integrated database retrieval system