KEGG   Anaplasma phagocytophilum HZ: APH_0473Help
Entry
APH_0473          CDS       T00327                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
aph00061  Fatty acid biosynthesis
aph00780  Biotin metabolism
aph01100  Metabolic pathways
aph01130  Biosynthesis of antibiotics
aph01212  Fatty acid metabolism
Module
aph_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aph00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    APH_0473 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    APH_0473 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    APH_0473 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aph01004]
    APH_0473 (fabI)
Enzymes [BR:aph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     APH_0473 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     APH_0473 (fabI)
Lipid biosynthesis proteins [BR:aph01004]
 Fatty acid synthase
  Component type
   APH_0473 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 DFP
Motif
Other DBs
NCBI-ProteinID: ABD43869
UniProt: Q2GKM8
LinkDB All DBs
Structure
PDB: 

Position
500764..501591
Genome map
AA seq 275 aa AA seqDB search
MRTGMLMEGKKGVIIGVANDKSLAWGIAKAVCAQGAEVALTYLSETFKKRVDPLAESLGV
KLTVPCDVSDAESVDNMFKVLAEEWGSLDFVVHAVAFSDKNELKGRYVDTSLGNFLTSMH
ISCYSFTYIASKAEPLMTNGGSILTLSYYGAEKVVPHYNVMGVCKAALEASVKYLAVDLG
KQQIRVNAISAGPVRTLASSGISDFHYILTWNKYNSPLRRNTTLDDVGGAALYLLSDLGR
GTTGETVHVDCGYHVVGMKSVDAPDISRVKGDHSV
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaccggcatgctcatggaaggaaaaaagggagtcatcattggtgtagctaatgat
aagtccttggcgtggggcatcgcgaaagctgtgtgtgcacagggtgccgaggttgctctt
acatatctttcggagacttttaagaaaagggtagatccccttgcggagtctctaggtgtt
aagttgacggttccgtgtgatgtatcagatgcggaatctgtagacaatatgttcaaagtt
cttgctgaggagtggggtagtctggattttgtggtccacgcggttgcattttccgataag
aacgagctcaagggaaggtatgttgatacttctctgggtaacttcctgacgtcgatgcat
atatcgtgttattcttttacttacattgcgagtaaagctgagccactgatgaccaatggt
ggcagtattttgactctctcttattacggtgctgagaaggtagtgccccattacaatgtg
atgggcgtgtgcaaggcggccctcgaggcaagtgttaaatatttggcggttgatttgggt
aagcagcagataagagttaatgctatttctgcggggcctgttagaactttggcgtcttct
ggaattagtgattttcattatatactgacgtggaataagtataattcgccgttgaggcgc
aatactactcttgatgatgtcgggggggctgcgttatatctgctgagtgatttgggtaga
gggacaactggtgagactgtgcatgtggattgtgggtaccatgtggtggggatgaaatcg
gttgatgctcctgacataagccgggtgaaaggcgatcatagcgtgtga

DBGET integrated database retrieval system