KEGG   Acyrthosiphon pisum (pea aphid): 100158725Help
Entry
100158725         CDS       T01076                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00052  Galactose metabolism
api00500  Starch and sucrose metabolism
api01100  Metabolic pathways
api04142  Lysosome
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100158725
   00500 Starch and sucrose metabolism
    100158725
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100158725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:api04147]
    100158725
Enzymes [BR:api01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100158725
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100158725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 100158725
NCBI-ProteinID: XP_001952639
APHIDBASE: ACYPI000163
LinkDB All DBs
Position
Un
AA seq 888 aa AA seqDB search
MHLKYNNIKVFIILFLQLLFLLHMYYSHSIPNELKFDCIPKGKSDEVTCKKMNCSWTPAN
QSFTRWPWCYYPECYNNYNTINISKTSTGVVAFYNLSVASSYKKNIQILRLDVIFETPQR
LRITIDDAVQIRYKPPFPKINEFKGNPIHGNNSLIISDLVVRLAKNGVGFAIIRKVDDTI
LFDSRNIGGFIFSDQFIQLSALLPSKYIYGLGEHRTNLVLDSNWKTYTMFNHDNTPKPDI
NGYGSHPFYLSMEKSGKSHGVFLFNSNAMDIILQPAPAITYRVIGGILDFYFFSGPTPSD
VITQYTEIIGRPFLPPYWSLGFHLSRYGQTFEDLIQVYNRTIEAGIPWDTHWNDIDYMDN
KDDFTLSNNFKQLPEYVNNLHKNGMHHIVILDPGLKSRQSNGTMYVPLKDGLNDNIFIKN
SAGQPLEGKVWNDIGTVFPDFTHPKATQFWKNQLLNFHNIVKFDGLWLDMNEPANFVNGD
LNGCSSYKSDHWEVPPYIPGIVGGRLNYKTICMSAIHFAGIHYNLHNLYGLVETISTHDA
LSEIKNTRPFVISRSSYPGFGHYAGHWTGDINSSWDDMKQSITDIINFNLFGIPLVGADI
CGFHHDTTIELCSRWIQLGAFYPFSRNHNGQYMKDQDPAALGSNVLSSAKKSLITRYYLL
PYLYSLFWKAHVYGETVVRPLFFEYPYDDNTYGIDTQFLWGAALLILPVLKEKNHHVYVY
LPKDIWYDFYNKTAILSNGNHFVITAPADTIPLLVRGGFILPTQMAASTTTLSRQNHFEL
LVATKHDQATGFLFFDDGKSLDSWKNDSYNKVQFKLVNTTFSSIVEMNSYIDDNFVLQNI
TVLGVKQGPTNSQVNGVPFNGYYFNKTEQVLYFKMLNLNLRMPFNLTW
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgcacttaaaatataacaatatcaaggtcttcataatactgtttctacaattgttattc
ttattacatatgtattacagtcactcaataccaaatgaactaaagtttgattgtataccc
aaaggaaagtctgatgaggtaacctgcaaaaaaatgaactgttcctggacaccggcaaac
caatcttttactcgatggccgtggtgttattatccagaatgttacaataattataataca
attaatatatcaaagacaagtactggagtagtagcgttttataatttatcagtggcttct
agttacaaaaaaaatatacaaatcttgcgtctggatgttatttttgaaacaccacaaaga
ctacgaattacgattgatgacgctgttcaaatacgttacaagccaccctttccaaaaatt
aacgaatttaaaggaaacccgattcatggaaataatagtttgataatatccgatttagtt
gtaagactggctaagaacggtgttggatttgctattattcgtaaagtggatgatacaatt
ttgtttgatagtcgaaatattgggggttttatattttctgatcaatttattcaattgtcg
gctttactaccctcaaagtacatttatggattgggtgaacatagaactaatttggtcttg
gattcaaattggaaaacatatacaatgtttaatcacgacaatactccaaaacctgatatc
aatggctatggctcacatccgttttatttatcaatggaaaaatccggaaagagtcatgga
gtttttttatttaatagcaatgctatggatattatactgcagcctgcgcctgcaattaca
tatcgcgtaattggcggaattttggatttttattttttttctggaccaacaccgtctgat
gttattactcagtacactgaaattattggcagaccatttttaccaccgtattggtcttta
ggtttccatttgagccgatatgggcagacttttgaagatctcattcaagtttataatagg
accatagaagctggtattccttgggacactcactggaatgacattgattatatggataat
aaagacgatttcacactttctaacaattttaagcaactacccgaatatgtgaataattta
cacaagaatggaatgcaccatatagttattttggatccaggccttaaatcacgacagtct
aatggaacaatgtatgttcctttaaaggatggtcttaacgacaatatttttataaaaaac
tctgctggtcaaccattggaaggaaaagtttggaatgacattggaactgtatttcctgat
tttacacatccaaaagcaactcaattctggaaaaaccagcttttaaattttcacaatatt
gtaaaatttgatgggttatggttggatatgaatgaaccggctaattttgtcaatggtgat
ttgaatggatgttcttcttataaatctgatcactgggaagtacctccatatatccctggt
atagttggtggccgtttgaactacaaaactatttgcatgtctgcaattcattttgctggt
attcactataatttgcataatttatatggacttgttgaaactatttccactcacgatgca
ttgtcagaaataaagaatactaggccttttgtcatttcaagatcttcttatcctggtttt
ggacattatgctggtcactggactggagacataaactcttcatgggatgatatgaaacaa
tccataacagatataataaattttaatttattcggtattcccctagttggggcagatata
tgtggttttcaccacgacactactattgagttgtgttcaaggtggattcaattaggtgcc
ttctatccattttctaggaatcataatggccagtacatgaaagaccaagatccagcagct
ttaggatcaaacgttttgtcatctgcaaaaaaatcattgattactagatattatttatta
ccatatttgtattcattgttttggaaagctcatgtttacggagaaactgtcgttcgacct
ttgttttttgaatatccatatgatgataatacatatggcatagacactcagtttctatgg
ggtgcagccttactaatcttaccagttttaaaagaaaaaaatcatcatgtgtatgtatat
ctcccaaaagatatatggtatgacttttacaataaaactgcaatattgagcaacggaaat
cattttgtcataacagctcctgccgacactatacccttactggtacgagggggttttatt
ttacccacacaaatggctgcttcaactacaacattaagtcgtcaaaatcactttgaactc
ttagtagcaactaaacatgaccaagcaaccggttttttattttttgatgatggaaagtct
ttagattcttggaaaaatgattcatataacaaagtacaatttaagcttgtgaacactaca
ttttccagtatagtggagatgaatagttatattgatgacaactttgtattacaaaatatt
actgtgcttggtgtcaaacaaggaccgaccaattcacaagttaatggagttccattcaat
ggttattacttcaataaaactgaacaagttttatacttcaaaatgttaaacttaaatcta
aggatgccattcaatttaacatggtaa

DBGET integrated database retrieval system