KEGG   Acyrthosiphon pisum (pea aphid): 100159783Help
Entry
100159783         CDS       T01076                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00040  Pentose and glucuronate interconversions
api00051  Fructose and mannose metabolism
api01100  Metabolic pathways
Module
api_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100159783
   00051 Fructose and mannose metabolism
    100159783
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100159783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Methyltransf_16 Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 100159783
NCBI-ProteinID: XP_029341705
APHIDBASE: ACYPI001130
LinkDB All DBs
Position
X
AA seq 359 aa AA seqDB search
MANASVNNEKDNLTSVLYGVRDLRLEQRPIPIPGHNEVLLKIQRVGICGSDVHYLVHGAI
GHYIVKEPMVIGHEASGIVVKLGEGVKSLKVGDRVAIEPGVSCRMCQFCKLGSYNLCPDM
KFCATPPVDGNLTRYYVHAADFCYKLPDHISLEEGALLEPLSVGVHACKRGGVKVGSTVL
ILGAGPIGLVTLVTAKAMGATKIYITDLTEFRLNVAKEMGAYKAIKVNRGDSDEQAIENV
RSEMDNEFPDVTIDCSGFQQTIKMGMELTKSGGVLTIVGMGAAGNVQLPLFNALSREVDI
RGVFRYANDYQDALALLSTGQINMKPLITHNFKIEESLEAFKTAETGIGNAIKVMIHCN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgcaagtgtaaacaacgaaaaggataatttaacttcagtactctatggtgtt
agagatttacgacttgaacaacggccaatacccatacctggtcataatgaagtattattg
aagattcaacgtgtaggaatatgtggttcggatgtccactatttagtgcatggagctata
ggtcactatattgttaaagagccaatggttattggtcatgaagccagtggaattgtagtg
aagcttggagaaggtgtaaaaagtctcaaagttggtgatagagtagcaattgaaccagga
gtatcatgtcgcatgtgccagttttgtaagcttggctcatacaatttatgtccagatatg
aaattctgtgctacaccacctgtagatggaaatttgactcgttattatgtccatgctgct
gatttttgttataaattaccagatcatatatctttagaagaaggtgctctattagaacca
ctttctgttggagtccatgcttgcaaaaggggaggtgttaaagttggttctacagtatta
attttaggagctggaccaatcggtttggttacattggttaccgcaaaagctatgggggct
actaaaatttatataacagatctaacagaattccgattaaatgtagctaaagaaatggga
gcttacaaagcaatcaaagtaaatagaggagattcagacgaacaagcaatagaaaatgta
agaagtgagatggacaacgaatttccagatgttactattgactgcagtggttttcaacaa
acaattaaaatgggaatggagctgacaaaatctggaggagtattaacaattgttggaatg
ggagcagcaggcaatgttcaattgccattattcaatgcattatctcgagaagtagacatc
agaggagttttccgctatgccaatgattaccaagatgcattggctttactgtctacagga
caaataaacatgaaaccactaatcactcataattttaaaattgaagaatcattggaagct
tttaaaactgctgagactgggattggtaatgcaattaaagttatgatacactgtaactaa

DBGET integrated database retrieval system