KEGG   Acyrthosiphon pisum (pea aphid): 100162590Help
Entry
100162590         CDS       T01076                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:api01009]
    100162590
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:api03019]
    100162590
   04131 Membrane trafficking [BR:api04131]
    100162590
   03036 Chromosome and associated proteins [BR:api03036]
    100162590
Enzymes [BR:api01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100162590
Protein phosphatases and associated proteins [BR:api01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100162590
Messenger RNA biogenesis [BR:api03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100162590
Membrane trafficking [BR:api04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100162590
Chromosome and associated proteins [BR:api03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100162590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100162590
NCBI-ProteinID: XP_016664552
APHIDBASE: ACYPI003736
UniProt: J9JTS5
LinkDB All DBs
Position
Un
AA seq 839 aa AA seqDB search
MENQIKVKPTTSALIAARKKEFLETNNMKGRQMYDHVQDDFKNARSFIDKSIKSTGIIYD
DQFANHLCAWDINYPENPQRYESIIERCNELGLIERCIKIQCRNATNDELLMKHSQSIID
ILKSTDDIQSVDLLQTLSSKFDAIYFHPSTYKQSLLATGSSIELVKAICENKIQNGMAFI
RPPGHHAMKSEFCGYCFFNNIAITAEYVLRHYSVSKILIVDWDVHHGQSTQQMFYDDPRV
LYFSIHRYEHGQFWPNLRESDWDYTGNGDGQGFNINVPLNATGMRDTDYLAIFHQILLPV
ASEFQPDLILISSGYDAALGCPEGEMEVTPACYAHLVHSLMGFACGRVAVLLEGGYCLKS
LAEGAALTLKSLLGDPCPSLDMTSNPCTSIIQTIQNVIFAHQKYWKCFQVDFLLSQSFKA
VSMYSYDEEPLSVFPTVDCYPTQDISKIDEFSVLQHLISETQLLNINNKVCVSFDLIMDQ
KHESSESGHPECPGRISAILNMYNEFQLTHRLLILPSREAEESELLLAHSREHVDEMSNL
HKLSPSELSEKEKCYDSVYLTTDTYKVSTLASGCLLQVVDSVMKNESASGVAVIRPPGHH
AELDIACGFCIFNSVAIAASYALNKYGLKRIMILDWDIHFGNGTMRAFSSDPRVLYISIH
RYQNAKFFPCSEEGSHKVTGSGSGEGYTINIPWNKNGMGDAEYISVMQNIILPVAYEFCP
ELVLVSAGFDAAVGDPLGGCKVTPECYGHLTHFLSSLANGKIILALEGGYNIDAVSYCMT
MCTKALLGDPLPPLDLEFPICKNAQKTIKRVVNVQKNYWSCFKYFNYERTSKHSFSIND
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaattaaagtaaaacccacaacaagtgctctaatagctgcaagaaaaaag
gaatttctggaaacaaataatatgaaaggtcgtcaaatgtatgaccatgtgcaagatgat
tttaaaaatgctagaagttttattgacaagtcaattaaaagtactggaattatttatgat
gatcagtttgctaaccatttgtgtgcttgggatattaactatccagaaaatcctcaacga
tatgaatcgatcattgaaagatgtaatgagttaggattgattgaaagatgtattaaaata
caatgccggaatgctactaatgatgagttattaatgaaacattcacaaagtataatagac
atattaaaatctactgatgacatacaatcggttgatcttttacaaacattgtcttctaaa
tttgatgcaatttactttcacccgtcaacgtataagcagtctttgttagctacaggtagt
tcaatagaacttgttaaagcaatttgtgaaaacaaaattcaaaatggaatggcttttatc
agacctcctggacatcatgctatgaaatcagaattttgtggctattgttttttcaacaat
atagctataactgcagaatatgttcttcgccactattcggtttctaaaattttaattgtt
gattgggatgttcatcacggacaatctacacaacaaatgttttatgatgatccaagagta
ttgtatttctctattcatcgttatgaacatggacagttttggccaaatttgcgtgaaagt
gattgggactatactggtaatggtgatggccaaggtttcaatattaatgtacctcttaat
gctactggcatgagagacactgattaccttgccatttttcatcaaattttattaccagtc
gcttccgaattccaaccagatcttatattaatatcatctggttatgatgcggctctagga
tgtccagagggagaaatggaagttacacctgcatgttatgctcatttagttcattctctt
atgggttttgcgtgtggtagagttgctgttttacttgaggggggttattgcttgaaatca
ttagcagaaggtgcggcattaacactaaaatcattactcggagatccatgtccatccctc
gatatgactagcaatccatgtacaagtattatacagacaatacaaaatgtaatttttgca
catcaaaagtactggaaatgttttcaagttgactttttgttaagtcaatcgttcaaggca
gtatctatgtattcatacgatgaggaaccattgagtgtgtttccaactgttgactgttat
cctactcaagatatctcaaaaatagatgaattttcagttcttcaacatttaatttctgag
actcaattattaaacataaataataaagtttgtgtttcgtttgatctgattatggaccaa
aaacatgaaagcagtgaaagtggacatccagaatgccctggtagaataagtgcaattttg
aatatgtacaatgagtttcagttgacacatcggcttttaattttaccatcaagggaagct
gaagaaagtgaattactccttgctcattctagagaacatgtagatgaaatgtcaaacttg
cacaaattatcgccatcagaattgagtgaaaaagaaaaatgttatgattctgtgtatttg
actacagatacatataaagtctctacgctagcatctgggtgtttgttgcaagttgttgat
tccgtaatgaagaatgaaagtgcatcgggcgtagctgtaattcgtcctcctggtcatcac
gcagaacttgatatagcttgtggtttctgtatctttaattctgttgctattgctgcaagc
tatgctttgaataagtatggtctcaaaagaattatgattttggactgggacatacatttt
ggtaatggcacgatgagagcgtttagttcagatccaagagttttgtatatatcaatacat
cgttaccagaacgcaaaatttttcccatgctctgaagaaggctcacataaggtgacaggt
tcagggagtggggaaggatataccattaatataccatggaataaaaatggcatgggtgat
gctgagtacatctcagtcatgcaaaatataattttaccagtcgcctatgaattttgtcct
gagctcgtcttggtgtcagctggatttgacgctgcagttggggatccactcggaggttgt
aaagtgacacctgagtgttatggacatctcacacattttctgtcatctttagctaatggt
aaaatcatacttgccctagaaggaggctataatatagatgcggtttcatattgtatgacc
atgtgcacgaaagctttacttggagatcctctaccccctttagacctggaatttcccatt
tgcaaaaacgctcagaagacaataaaaagagtagttaatgtacaaaaaaactattggtcg
tgttttaagtatttcaattatgagagaacaagtaaacactcatttagtattaatgattaa

DBGET integrated database retrieval system