KEGG   Acyrthosiphon pisum (pea aphid): 100162863Help
Entry
100162863         CDS       T01076                                 

Definition
(RefSeq) maltase 1-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00052  Galactose metabolism
api00500  Starch and sucrose metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100162863
   00500 Starch and sucrose metabolism
    100162863
Enzymes [BR:api01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100162863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 100162863
NCBI-ProteinID: XP_016659854
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
MFKIIAVLWLFVSNSLVSSEFIRGSLSNSFEPNWWQANTFYQIYVRSFKDSDGDGIGDLN
GITEKVSYIKSLDVSAIWLSPIFLSPQNDFGYDISDYEEIDPVEFVPILFMVFTMEDFER
LRNKFHKNGIKVLLDFVPNHTSDEHEWLQKSIMRIEPFTNYYVWKDPIIDKNGNKTPPSN
WLSAFNSGSAWKWNEQRRQYYLHQFQEKQPDLNYRNPSVREAMKVVSSLIDKKIYIITLT
SQLIKPFI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaattattgcagtcttgtggctgtttgtgtcaaacagtttggtgtcatctgaa
tttattcgtggaagtttaagtaactcctttgaaccaaactggtggcaagcaaataccttt
taccaaatatacgtgagatcattcaaagacagcgatggtgacggaattggagatctcaat
ggtataaccgaaaaagtgtcatacattaaaagtttagatgtcagtgcaatttggttatcg
cctatattcctctctccgcaaaatgatttcggttatgatatatcggactatgaagagatc
gatcctgttgaatttgttccgatcctgtttatggtgtttacgatggaggactttgaacga
ttgaggaacaagtttcataaaaatggtataaaagttttgttggactttgtgcccaaccat
acaagtgatgaacacgaatggctccaaaaatcaattatgagaattgaaccctttaccaac
tattatgtatggaaggatccgattattgacaagaatggcaataagacacctccaagtaac
tggttaagtgcattcaatagcggatctgcgtggaaatggaacgaacaacgacgacagtat
tatttacatcaattccaagaaaaacaaccagacttgaactacaggaatccatcagttaga
gaagcaatgaaggtagtctcatcacttatcgataaaaaaatatacattatcacattgaca
agtcagctaatcaaaccttttatataa

DBGET integrated database retrieval system