KEGG   Acyrthosiphon pisum (pea aphid): 100163173
Entry
100163173         CDS       T01076                                 

Definition
(RefSeq) MAP kinase phosphatase with leucine-rich repeats protein 3
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100163173
SSDB
Motif
Pfam: CDI SMP_2
Other DBs
NCBI-GeneID: 100163173
NCBI-ProteinID: XP_001947107
APHIDBASE: ACYPI004275
UniProt: J9JV90
LinkDB
Position
A2
AA seq 215 aa
MTVTYGVTGTNADGGGSVNNGRRVLMAKTDSLSNVNNNNNSTSVNNNNGSSSITGKASVL
SVRRVLFGPPADPAETRAWLDRQLCAATAADSRSWNFDFVNERPLRDSPADRYAWERVCP
PKRREESAAADSTITATAQQQQQQQQQEDCSRTVVKQQRQSKVTDFMSKTKKRPLSASGR
TLRSNNKVVDESESANKRSRRSVATTTTTTTMMAI
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaccgttacgtatggcgtgacggggacgaacgccgacggaggaggatccgtaaacaat
ggtaggagagtgctcatggcgaaaaccgattccctgagcaatgtcaacaataacaacaac
agcaccagcgtcaacaataacaacggatcgtcgtcaatcacgggcaaggcgtccgtgttg
agcgtcaggcgcgtgctgttcgggccgccggccgacccggcagagacgcgggcgtggctt
gatagacaattgtgtgcggccaccgcggccgattcgcggtcgtggaactttgatttcgtt
aacgaacgtccgctgcgtgacagcccggccgaccgttacgcgtgggaacgcgtctgtcca
ccgaagcgtcgtgaggagtcggccgcagcggactcgacgatcactgcgacagcacaacaa
caacaacagcaacaacaacaagaagattgcagccgaacggtcgtcaagcagcagcgacag
tccaaagtcacagatttcatgagcaagaccaagaaacgaccgttgagtgcttccggcagg
actctacgctcgaacaacaaagtcgtggacgaatccgaatcggcgaacaagcggagtcgc
cgttcggtcgcgacgacgacgacaacgacgacgatgatggctatctaa

DBGET integrated database retrieval system