KEGG   Acyrthosiphon pisum (pea aphid): 100163190
Entry
100163190         CDS       T01076                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00230  Purine metabolism
api01100  Metabolic pathways
api04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100163190
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100163190
Enzymes [BR:api01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100163190
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 100163190
NCBI-ProteinID: XP_029345607
APHIDBASE: ACYPI004290
LinkDB
Position
X
AA seq 1036 aa
MESTPPPTSAAGASTSSPNAGRFADRATESLYQSYNAKQKRAAFACYVSASVLFDVYCLS
VYDARSPWTWCLLAANVGTLLWCRLAGGRRRYWTFVAHLAWLTANVQVVFHMVANAAEGA
DLLGWILLYDYLAYVSLPLTLALCIALSATTCLTYVITMAVLGRHHAYLARQLATNSVLL
LASNCLGLLSYFLADKQQRTAFLETRQCLEMKMVIEEQSTEQERLLLSVLPEHVAVKMRQ
DLGEALDSQFKKIYMSRHENVSILYADIVGFTAISSTYSASDLVKILNELFARFDRLSEK
YQQLRIKILGDCYYCISGAPKERPDHAVLSVHMGLSMVKAIKYVQQTTNSPVDMRVGIHT
GAVLAGVLGQRQWQFDVYSKDVELANKMESSGMPGRVHISEKTLSFLNGEFEVEPGYGER
REEALKMASIKTFFIIKTIKPFKMDVQNGSLNDQHSASKESVCATPIDDADLIAQAKEDS
DNFKKRLRKDLMNRDGHRDLNKHTKFFTLAFNDEAKEREYKYHKEAASGVSLIGCPLVLF
LTSSAQIIMLPRDILSYMSSCLALVLLLIIVVVSVADIFPRILPSKIVWFSETINDSLWI
RRILGITAASLLASTNLVGLVSCWSEKQILTNCTHGQSDPSTYCMYPSYFTYFMVLALIA
TSMLTQLSHFTKATILFVITLMHCVVNVVTVGTAIDCEDSIIYKPFKVLPSKYALSFLLI
AVTMALVFLARNMDKSSRVLYLWRTEVEEQRERASDIRRRNEALVYNILPPHVAKHFLGS
YKRQHEELYSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLEQP
RYQDIIKIKTIGSTYMAASGLNPSRVVKPEDPIEVRWAHLALLVDFAFDLKRALQGINEQ
SFNHFVLKMGINHGPITAGVIGARKPHYDIWGNSVNVASRMESTGKAGCIQVTEETCNIL
QHFGFKFEQRGLVAVKGKGQLMTYYLVGKGLQPSQVPPPIMETLPEVEEEDTDDSMVVRQ
ALLPRTDHNGSATASG
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggaatccacgccaccgccgacttcggcggccggcgcctcgacctcttcgccaaatgcc
ggacggttcgcggacagggccactgagagcctgtaccagagctacaacgccaagcagaag
cgcgcggcgttcgcttgttacgtgtccgcgtccgtgctgttcgacgtgtactgcctgtcc
gtgtacgacgcccggtccccgtggacgtggtgcctgctggccgccaatgtgggcacgctg
ctgtggtgcagactggccggcggccggcgccggtactggacgttcgtggcccacctggcc
tggctcacagccaacgtccaggtcgtgttccacatggtggccaacgcggccgagggcgca
gacctgctcggatggatactgctctacgattacctggcctacgtgtccctgccgctcact
ctggccctgtgcatagccctgagcgccaccacgtgcctcacctacgtgatcaccatggcc
gtgctgggccgtcaccacgcgtacctcgcccgacagttggccaccaacagcgttctcctt
ttggcgtccaattgtttgggacttttgtcctatttcctggccgacaagcagcagcggacc
gcctttctggaaacccggcaatgtctcgagatgaaaatggtcatagaagaacaatcgacc
gagcaggaacggctgttgttgtccgtgttaccggaacacgtagccgtcaaaatgcgccag
gatttgggtgaggcattggacagtcaattcaaaaagatatacatgagtcgacacgaaaac
gttagtatattgtatgccgacatcgttggattcacggcaatatcgtcaacatactcagcg
tccgacctggtgaaaattctcaatgagctcttcgccagattcgatcgactgtccgagaaa
taccaacaactcaggatcaagattttgggcgattgttactattgtattagcggcgctccc
aaagaacgacccgatcacgctgtgctcagcgtgcacatgggactatccatggtcaaagct
atcaaatacgtacaacagacgaccaactcgccggtggacatgcgggtgggcatacacacg
ggagctgttttagccggtgtcctgggtcagaggcagtggcagttcgacgtttactccaag
gatgtggaattggcgaacaaaatggaaagcagtggaatgcccggacgagtgcacatatcc
gaaaaaactttgagtttcttaaatggagagttcgaggtcgagcccggctacggagaacgg
cgtgaagaagctctcaagatggccagcataaaaactttcttcatcataaaaactatcaaa
ccgttcaaaatggacgtgcaaaacggatcgttgaacgatcagcacagtgccagcaaagaa
tctgtgtgtgcgacaccgattgacgacgccgatttaatagctcaggccaaagaggactcc
gataactttaagaagcgattgagaaaggacttgatgaacagagatggccacagggatcta
aacaagcatacaaaatttttcactttggcatttaatgatgaagcaaaagaacgcgaatac
aaataccacaaagaagctgcatctggtgtatctcttataggttgtccgttagtactgttc
ttgacgtcttccgcacaaattattatgttgcccagagatattttaagctacatgtccagt
tgtcttgcattagtattactattgattattgtagtggtatcagtcgcagacatttttcca
agaattctgccatcgaaaattgtatggttcagtgagaccataaatgattctttatggatt
cgacgtatactcggcatcactgccgcgtcattgctagcgtctaccaatctcgtgggactt
gtatcgtgttggtcagaaaaacaaatacttaccaactgcacgcatggccaaagcgatcca
tcgacttattgtatgtatccatcatacttcacttacttcatggtgttggccctaatagcc
acgtccatgttgactcaattgtctcatttcaccaaagcaactatactgttcgtcatcact
ctgatgcattgcgttgtcaacgtagttacagtaggcactgctattgactgcgaagactcg
atcatttacaaaccgttcaaagttttgccatcgaagtatgcactgtcgtttctactcata
gccgtcacaatggcactagtgtttttggctagaaatatggacaaatcgtcgagagttcta
tatctatggcgaacggaagtcgaagaacagagggaaagggcttcagacatacgaaggaga
aacgaagcattggtgtacaatattttgcctccgcacgtagccaaacatttcttaggtagt
tacaaacgccagcacgaagaactatacagtcagagctatgccgaagttggagttttgttc
gcatctatgccaaacttttcagatttctattcggaggagacggttaacaatcaaggtctc
gagtgcttgagatttctcaatgaagttatatctgattttgatgcgcttctggaacaacca
cgctaccaggatattattaagattaaaacaatcggttcaacttatatggctgcaagtgga
ctaaacccttcgcgtgtcgtaaagcccgaagatccaattgaagttagatgggcacacctc
gcattgctggtggactttgctttcgatctcaaaagagcacttcaggggataaacgaacaa
agctttaaccactttgtattgaaaatgggaatcaatcatggtccgataaccgccggagtt
attggtgcgagaaaacctcattacgatatttggggaaattctgtgaatgtggcatcaagg
atggagagcactggaaaggctggatgcatacaagtgacggaagaaacgtgtaatattctg
caacatttcgggttcaagttcgaacagcgtggcctagtggcggtcaagggcaaggggcag
ctgatgacctattacttggtgggcaaagggctccaacccagccaggtgccgccgccgatc
atggagacgctgcccgaagtggaggaagaagacacggacgatagcatggtggtcaggcag
gcgctgttgcctcggaccgatcacaacgggtccgcaaccgcttccggttga

DBGET integrated database retrieval system