KEGG   Acyrthosiphon pisum (pea aphid): 100164587Help
Entry
100164587         CDS       T01076                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00250  Alanine, aspartate and glutamate metabolism
api00280  Valine, leucine and isoleucine degradation
api00410  beta-Alanine metabolism
api00640  Propanoate metabolism
api00650  Butanoate metabolism
api01100  Metabolic pathways
Module
api_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100164587
   00650 Butanoate metabolism
    100164587
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100164587
   00280 Valine, leucine and isoleucine degradation
    100164587
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100164587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:api01007]
    100164587
Enzymes [BR:api01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100164587
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100164587
Amino acid related enzymes [BR:api01007]
 Aminotransferase (transaminase)
  Class III
   100164587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 100164587
NCBI-ProteinID: XP_008190023
APHIDBASE: ACYPI005585
UniProt: J9JYS0
LinkDB All DBs
Position
Un
AA seq 494 aa AA seqDB search
MYRFQDVARPAATAAKHFVGAPLRMASSICPGEYAAPSVETSVPGPKSKKLLADLSQMQQ
SGSVQLFADYNKSLGNYLVDVDGNVLLDVYTQISSLPLGYNHPDMLKVLDSDENKRAIVN
RPALGVFPAADWPVKLRDTLMSVAPKGMDSLTTMMCGSCSNENAYKNMFMKYQRDKRGGT
SDFTDLEKESCMINMPPGAPKLSILSFKGSFHGRTLGVLSTTHSKYVHKLDVPAFDWPMA
RFPEYKYPLHENLKENEQEDERCLAEVEELIEKWEKKGNPVAGIVVEPIQAEGGDNHASP
YFFQKLQKIAKKYNAGYLIDEVQTGGGPTGKMWCHEHFDLETSPDIVTFSKKMQTGGYYL
KKEFLPDLPYRVFNTWMGDPTKIVLLDAILKVIKRENLLSVVEKSGDVLMSGLRDLEAEF
PALINSTRGRGTFITFDAADAKLRDDIVKRLLAKGVQSGGCGVVGIRMRPALIFQPHHAH
MFNDRLRQVLVETK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtacagattccaagacgtagcccgtccagcggcgacggcggccaaacattttgtcggc
gcaccactgagaatggcatcatcaatttgtcccggagaatatgctgcaccgtcggtcgaa
acgtcagtaccaggaccgaagtcaaaaaaactacttgctgatctttcacaaatgcagcaa
tctggttcggttcagctattcgctgactataacaaatcactgggaaactacttggttgac
gttgacggtaacgttctgttggacgtgtacacgcaaatttcgtcattgccgttgggttac
aaccacccggacatgttgaaagtattggacagcgatgagaacaaaagagccatcgtcaat
cgtccggcgttgggtgtgttcccagctgccgattggccagtgaaactacgagacacactt
atgagtgtcgcacctaaaggtatggactctctaacgaccatgatgtgtgggtcttgttcc
aacgagaacgcgtacaaaaatatgttcatgaagtaccagcgggataaaaggggaggcact
tcggacttcacagacttagagaaggagtcatgcatgattaacatgccgccaggcgcaccc
aagctatctatactgtcgttcaagggttcgttccacggccgcacactgggcgtcctatct
accacgcattctaagtacgtgcacaagttggacgtgcccgcgtttgactggccaatggca
agattccccgagtacaagtatccgctgcatgagaacctcaaggaaaatgaacaagaagac
gaacgttgcttggctgaagtggaggaactgatagagaagtgggaaaagaagggcaacccc
gtggccggaatcgtcgtggagcccatccaggcggaaggcggagacaaccacgcatcgcct
tatttcttccagaaacttcagaagattgccaaaaagtacaacgcgggatatctaatcgac
gaggtgcagacaggcggcggccccaccggtaaaatgtggtgtcacgagcatttcgatctg
gaaacttcgcccgacatcgttacttttagcaagaaaatgcagaccggtggatactacttg
aagaaggaattcttacccgacttgccgtaccgtgtgttcaacacttggatgggagatccg
accaaaatcgtattgctcgatgctatattgaaggtgatcaagagagaaaatctgttgtcg
gtggtcgaaaagtccggcgatgtactcatgtccggactcagagacttggaagccgagttc
ccagcactaatcaactccaccagaggccgcggtacattcataacgttcgatgctgctgac
gcaaaactccgagacgacatcgtcaaaagacttttagccaaaggagtccaatccggagga
tgtggagtagtgggtattagaatgcgaccggcgttgatctttcaaccacatcacgctcac
atgttcaatgacagacttcgccaggtgttggtcgaaactaaatag

DBGET integrated database retrieval system