KEGG   Acyrthosiphon pisum (pea aphid): 100164650
Entry
100164650         CDS       T01076                                 

Definition
(RefSeq) protein suppressor 2 of zeste isoform X3
  KO
K20017  Bcl-2 family protein
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04214  Apoptosis - fly
api04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:api00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100164650
   04215 Apoptosis - multiple species
    100164650
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100164650
NCBI-ProteinID: XP_001948797
APHIDBASE: ACYPI005643
LinkDB
Position
X
AA seq 405 aa
MTERNGRCSPAVKIADSSSGRCNEARRMSEGGLVMSSCAAANFNNNNNNNTTNTNNNNHN
GGSRTTAAVPRRKFSFPAVLQSHSLQSELGGIDFGGGPSLTVATARRRFSNVSDVVSRKL
SHTIGWRTAVPTEQIARQGKALCVQYVRWKLKRAGAYTKKCAAALRAASAAANPAASVDG
NASGGSGGYFIPPLQAMAAATDHIDSVRRDVFPAVLRVGLQLERLDPKLYAAGTVATDTA
ATTAASTAGTAGNPSAAAAMTGPAAPPQRLFQRHRPAYRRNTAAASVVLVSVSRELFRAG
AQVTWAKVVSLVCVAAGLAVDCARRGRADQLPDLIEAVGEVIEDDLAAWIHYNGGWMGLQ
SYCKPVVVNIENPVSTQILYLVSLLIVVIFFLLLLRWFDFISVFR
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgactgaacgcaacggtcggtgttcgccggcggtgaaaatcgccgacagttcttccggc
cggtgtaatgaagcacggcgcatgtccgaaggtggtctcgtcatgtcttcatgcgcggct
gccaacttcaacaacaacaacaacaacaacaccacaaacacaaacaacaacaaccacaac
ggcggcagcaggacgacggccgctgtgcccaggcgcaagttcagcttcccggcggtgttg
caatcgcacagcctgcaatctgaactgggcggcatcgacttcggcggtgggccgtcgctc
actgtggccacggcccgccggcggttcagcaacgtcagcgacgtcgtgtccaggaaactg
tcgcacaccatcggttggcggacggccgtgccgacggagcagatcgcgcggcagggcaag
gcgctgtgtgtgcagtacgtccggtggaagctgaagcgggctggcgcgtacacgaaaaaa
tgcgctgctgcgttgcgtgcggccagcgcggccgctaaccccgcggcttcggtggacgga
aacgccagtggcggaagtggtggctacttcataccgccattacaggcgatggcggctgcg
accgatcacatcgatagtgtgcgtcgcgacgtgttcccagccgtgctccgggtcgggctc
cagttggagcggctcgacccgaaactgtacgcggccggaaccgtggccactgacactgcg
gccaccactgctgcgtccacggccggtactgcaggcaacccatcggcagccgcggcgatg
accggcccggctgctccgcctcagcgcctgttccagaggcaccggcccgcgtacaggaga
aacacggccgcggcttctgtcgtcctggtgtccgtatcccgggaactgttccgggccggc
gcccaggtcacgtgggctaaagtcgtgtcgcttgtgtgcgtggccgccgggcttgctgtc
gactgcgcgcgccgcggccgtgccgatcagctgcccgacctgatcgaggccgtcggcgaa
gtaatcgaggacgatctggccgcttggatacattacaacggcggatggatggggctccag
tcgtactgcaaaccggtggtcgtcaacatcgaaaatcctgtgtccactcaaatcttgtat
ctagtgtcattgctcatagtcgtcatatttttcttgttgttgttgaggtggttcgacttc
atatccgttttccgataa

DBGET integrated database retrieval system