KEGG   Acyrthosiphon pisum (pea aphid): 100166540Help
Entry
100166540         CDS       T01076                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00020  Citrate cycle (TCA cycle)
api00190  Oxidative phosphorylation
api01100  Metabolic pathways
api01200  Carbon metabolism
Module
api_M00009  Citrate cycle (TCA cycle, Krebs cycle)
api_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
api_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100166540
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100166540
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100166540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 100166540
NCBI-ProteinID: XP_001950339
APHIDBASE: ACYPI007401
UniProt: J9K3N0
LinkDB All DBs
Position
Un
AA seq 659 aa AA seqDB search
MSGLLKIVNPISRSTYSKINNWNRPLICTRNLHQSQYYSAKQSSAGTNAYSVIDHEYDAV
VVGAGGAGLRAAFGLVQEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEDDDWRWHMFD
TVKGSDWLGDQDAIHYLTREAPAAVIELENYGMPFSRTDEGKIYQRAFGGQSLQYGKGGQ
AHRTCCVADRTGHSLLHTLYGYSLKFNCNYFVEYFALDLIMDKGQCVGVIALCLEDGTIH
RFRAKNTVLATGGYARAYFSCTAAHTCTGDGQALASRAGIPMQDMEFVQFHPTGIYGAGC
LMTEGCRGEGGYLINGLGERFMEKYAPNAKELASRDVVSRSMTMEIMEGRGCGPEKDHVY
LQLYHLPAEQLHARLPGISETALIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRGQVINPE
NGEDKVVPGLYACGEAACTSVHGANRLGANSLLELVVFGRSCALDIAKCNKPGDKIPQIS
DNAGEESINNIDKLRFNSGTIPTADLRLDMQKTMQLYAAVFRTGSTLDEGRNKMQSIYSK
LKDIKINDRSMVWNSDLVESLELQNLMTTAQQTIVSAAERKESRGAHARDDFKDRIDEFD
YKKPLEGQTQVPIEKHWRKHTLACINPDTGEIKLTYRPVIDHTLDDKEVKSVPPMIRSY
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttattaaaaattgtcaatccaatatcacgaagtacttattcaaaaattaat
aattggaaccgtccattaatttgcacaagaaacttacatcaatctcaatattattcagct
aaacagagttcagcaggaacaaatgcatattcagtaattgatcatgaatatgatgctgtc
gtagtcggtgctggaggagctggtctccgtgccgcttttggcctagtacaagaaggattt
aaaacagcagttattactaaactatttccaacaagatctcatacggttgctgcacagggc
ggaattaatgctgcgttagggaatatggaagatgatgattggcgatggcatatgtttgat
actgttaaaggttcagattggttaggggatcaagatgctatacattatttaactagagag
gcacctgcagctgtcattgagttagaaaattatggtatgccttttagtcgtactgatgaa
ggtaaaatatatcaacgtgcatttggtggtcagagcttacaatatggaaaaggtggtcag
gctcatcgtacttgttgtgtagctgatagaacgggtcattccctcttacatactttatat
ggatattcattaaaatttaattgcaattactttgtggaatattttgctttggatttaatt
atggataaaggacaatgtgttggagtaattgctttatgcttggaagatggtactattcat
cgctttagagctaagaatacagttttagctactggtggttatgctagagcttacttttcg
tgtacagctgctcatacttgtacaggcgatggtcaagctctagcatcaagggctggtatt
ccaatgcaagatatggaatttgtacaattccaccctactggtatatatggcgctggctgt
ttaatgacagagggttgtcgcggtgaaggaggatatttaatcaatggtttaggtgaaaga
tttatggagaaatatgcacctaatgctaaagaacttgcatctagagatgttgtatctagg
tcaatgactatggaaatcatggaaggaagaggatgtggtccagaaaaagatcatgtttat
cttcaactatatcatttgccggctgaacagcttcacgctagattaccgggtatttcagaa
actgctttgatatttgctggagttgatgttactaaagaacctatacctgtgttgccaaca
gtccattataacatgggtggaataccaacaaactatagaggacaggttattaatcctgaa
aatggagaagataaagtagtacctggattgtatgcttgtggtgaagctgcatgtacttct
gttcatggagctaaccgtcttggtgctaattcattactcgagttggtggtatttggacgt
tcttgcgctttagacattgctaaatgtaacaaacctggagataaaataccacaaattagt
gataatgctggcgaagaatccattaataacattgacaaattacgttttaatagtggaaca
atacctacagcagacttacgtttagacatgcaaaaaactatgcaactttatgccgctgtg
tttagaactggatctacacttgatgagggccgcaataaaatgcaatccatttattcaaag
cttaaggatattaagataaatgatcgatcaatggtttggaattcagatttagtggaatca
ttagaattacaaaacttaatgactactgcacaacaaacaattgtatctgctgctgaacga
aaagaatccagaggggcacatgcacgagatgatttcaaagatcgtattgatgaatttgat
tataaaaaaccgttggaaggacaaactcaagtaccaattgaaaagcactggaggaagcat
acacttgcatgtatcaatccagacactggagagattaaattaacttatagacctgtaatt
gatcacacattggatgataaagaagtgaaatcagtgccacctatgattagatcttattaa

DBGET integrated database retrieval system