KEGG   Acyrthosiphon pisum (pea aphid): 100167056Help
Entry
100167056         CDS       T01076                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api03030  DNA replication
api03410  Base excision repair
api03420  Nucleotide excision repair
api03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:api00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100167056
   03410 Base excision repair
    100167056
   03420 Nucleotide excision repair
    100167056
   03430 Mismatch repair
    100167056
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:api03032]
    100167056
   03400 DNA repair and recombination proteins [BR:api03400]
    100167056
Enzymes [BR:api01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100167056
    6.5.1.6  DNA ligase (ATP or NAD+)
     100167056
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100167056
DNA replication proteins [BR:api03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100167056
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100167056
DNA repair and recombination proteins [BR:api03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100167056
   NER (nucleotide excision repair)
    Other NER factors
     100167056
   MMR (mismatch excision repair)
    Other MMR factors
     100167056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 100167056
NCBI-ProteinID: XP_008186579
APHIDBASE: ACYPI007879
LinkDB All DBs
Position
A2
AA seq 850 aa AA seqDB search
NGIKKEKDPPVLSVSTSSTSPEDLEVVHSSPIKTYGKRKKHAILFSDSDEETSDSKKKCA
KNTISNKPNDEKLEESIEEQSPLKDTDKSLIQDNEISESDCGTTKINDHPIKALQDQTQI
KTKCEEGSLPTHIESDNSDTDKKVSNKLITDKKNKLKKKSKKPSKTESPEKSDKSSEEQS
PTKDADGSPIHKKISESEYDPTKKNYHPIRDAFWNHNQPTPYSALTKTLLCIEEVSARLK
IIEILSNYFRSVIVVSPKDLLPSVYLCLNKVCPDYIGLELGIAETTLLKAIVQTTGRSMA
QVKSDVKKIGDLGIVAEKSKSNQKTMFKPARLTVKSVFDKLKDISEMTGHAVTVKKLDKI
QSMFIACQDSEARFLMRSLAGKLRIGLAEQSVLQALGLACTMTPPPQDFPPEILNAAKKM
SEEKFKKTYDGNTLIIKTTYCESPNLDIIIPIILEVGVSALPENCKLTPGIPLKPMLAHP
TKGVHEVLSRFDGLKFTCEWKYDGERAQIHLTEDGNICIYSRNQENNTSKYPDIINRLDS
VKGPNVKSFVMDSEAVAWDRENKKIMPFQILSTRKRKNANEADIKVQVCVYMFDLLYLNG
ESLVKRPFCERRQLLRENFIEVEEQFLLATSLDTTKMEEVQDFLEESIKGNCEGLMVKTL
EEEATYEIAKRSRNWLKLKKDYLDGVGDTIDVVVLGGYLGRGKRTGTYGGFLLACYDPDS
EEYQSICKIGTGFSDEDLQTHTEFFQQHIIDGPKSYYRFDQSHEPDHWFETVQVWEIKCA
DLSLSPVHRAALGIVDPEKGISLRFPRFLRIREDKSIEQSTSAQQIAELYYSQVQIINQG
STNTNREDFY
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
aatggaattaaaaaggaaaaagatccaccagttttatcagttagtacgtcttcgacatct
ccagaagatctagaagttgtccactccagtccaataaagacttatggaaaaagaaaaaaa
catgccatattatttagtgatagtgatgaagaaacatctgacagtaaaaaaaaatgtgca
aaaaatacaatttcaaataaaccaaatgatgaaaaattagaagaatccattgaagaacag
tctcctttaaaagatacagataaatcactaatacaggataatgaaatatctgaaagtgat
tgtggaacaacaaaaataaatgatcatcctataaaagctcttcaagaccaaacccaaatt
aaaacaaaatgtgaagaaggttcactgccaacccatatcgagtcagataattctgatact
gataagaaagtctccaataaactaattactgacaaaaaaaacaaattgaaaaaaaaatca
aaaaagccaagtaaaacagaatcaccggaaaaatcagacaaatcgagtgaagaacagtct
cctacaaaagatgctgatggatctccaattcataaaaaaatttctgaaagtgaatatgat
ccaacaaaaaaaaattatcatcctataagagatgccttttggaatcataaccaaccgact
ccatatagtgcactaaccaaaactttattgtgcattgaagaggttagtgctagattgaaa
attattgaaatactttcaaattatttccgctcagtgattgtggttagtcctaaagattta
ttaccaagtgtatacttgtgtttaaataaagtttgtcccgattatattggtttggaatta
ggcattgccgagactacacttttaaaggctatagttcaaacaacaggaagaagtatggca
caggtaaaatctgatgttaaaaaaatcggtgatttagggattgttgcagaaaaaagtaaa
agcaatcaaaaaacaatgtttaaacctgcccggctaactgtgaaaagtgtatttgataaa
ttaaaggacatctcagaaatgactggtcatgctgtgactgttaaaaaacttgataaaatc
caatcaatgttcattgcatgccaagattctgaagcaagatttttgatgcgatcattagca
gggaaattaaggataggacttgctgaacaatcagttctacaggctcttggtttagcttgt
acaatgacgccaccacctcaagattttccacctgaaatacttaatgcggcgaaaaaaatg
tctgaagaaaaattcaagaaaacttatgatgggaatactttaatcataaaaacaacttat
tgtgaaagtccaaatctagatataataatacctattatcttagaagtgggtgtaagcgcc
ttacctgaaaattgtaagttaactcctgggatacctttaaaaccaatgttagcacatcca
actaaaggtgtacatgaagtgctaagtagatttgatggattgaagtttacatgtgaatgg
aagtatgatggagaaagagctcagattcatttgacagaagacggaaatatttgtatttac
agtcgtaatcaagaaaataatactagtaaatatccagacattattaatcgtttggattct
gttaaaggtcctaatgttaaatcattcgtgatggattcagaagctgttgcatgggataga
gaaaataaaaaaataatgccatttcaaatattaagtactcgtaaacgaaagaatgccaat
gaagcggatattaaagtacaagtatgtgtatatatgtttgatttactctacctcaatgga
gaatctttagttaaaagacccttctgtgaacgtcggcaattattaagagaaaattttatt
gaagttgaagaacaattcttattagccacatcattagatacaaccaaaatggaagaagtc
caagattttctagaagaatctataaaaggaaattgtgaaggattaatggtcaaaacttta
gaagaagaagctacttatgaaatagccaagcgttcacgtaactggttaaaattaaaaaaa
gattatttggatggtgttggcgatactatagatgtagtagttttgggaggttatttaggt
cgtggaaaacgtactggtacttatggtggtttcctattagcttgttatgatccagatagt
gaagagtatcagagtatatgcaaaattggaacaggatttagtgatgaggacttgcaaaca
catacagagtttttccaacaacatattattgatgggcctaaaagttattaccgctttgat
caaagccatgagccagatcattggtttgagacagtccaggtatgggaaataaaatgtgca
gatttgtcattatccccagtgcacagagcagcattaggtattgtagatcctgaaaaagga
atttcgttaaggtttccaaggtttctacgtatacgagaagataagtcaattgaacaatct
acttccgctcaacagattgctgagttatattatagtcaggtgcaaattataaaccaagga
agtacaaatacaaatagagaggacttttactag

DBGET integrated database retrieval system