KEGG   Acyrthosiphon pisum (pea aphid): 100167265
Entry
100167265         CDS       T01076                                 

Definition
(RefSeq) fibroblast growth factor 1 isoform X3
  KO
K18496  fibroblast growth factor 1
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:api04052]
    100167265
   00536 Glycosaminoglycan binding proteins [BR:api00536]
    100167265
Cytokines and growth factors [BR:api04052]
 Growth factors
  Growth factors (RTK binding)
   100167265
Glycosaminoglycan binding proteins [BR:api00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100167265
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100167265
NCBI-ProteinID: XP_001945354
APHIDBASE: ACYPI008074
UniProt: J9K5F0
LinkDB
Position
A2
AA seq 154 aa
MDQEEEISQTSTCDVAASKRRVIKHYGRRMKLNCRHGYNILILQNGEVSSSDDDIDSNCI
MEFTSMSPGHVRIRGVEANLFLAMNKDGLLYGEADPNNNSTIFIEQPEGPYSAYLSLKYQ
RKKWYVAIKKNGKIKLGPTTKRGQHATHFLTIVV
NT seq 465 nt   +upstreamnt  +downstreamnt
atggatcaagaagaagaaatatctcaaacatcaacatgtgatgttgcagcatccaagaga
cgtgtgatcaaacattatggccgcaggatgaaattgaactgcagacatgggtataatatt
ttaatactgcaaaatggagaagtatccagttctgatgatgacatagacagcaattgtata
atggaattcacatcaatgtctcctggtcatgttcgtattagaggagttgaagcaaatttg
tttttggctatgaataaagatggacttctttatggagaagctgatcctaataataattca
acaattttcatcgaacaaccagaaggtccttacagtgcatacctatctttgaaatatcaa
cgaaaaaaatggtatgtggctataaaaaaaaatggcaaaataaaattaggtccaacaact
aaaagaggacaacatgctacacattttttaacaattgttgtatag

DBGET integrated database retrieval system