KEGG   Acyrthosiphon pisum (pea aphid): 100168185Help
Entry
100168185         CDS       T01076                                 

Gene name
Ance-like
Definition
(RefSeq) angiotensin converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:api01002]
    100168185 (Ance-like)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:api04147]
    100168185 (Ance-like)
   04090 CD molecules [BR:api04090]
    100168185 (Ance-like)
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100168185 (Ance-like)
Peptidases [BR:api01002]
 Metallo Peptidases
  Family M2
   100168185 (Ance-like)
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100168185 (Ance-like)
CD molecules [BR:api04090]
 Proteins
  100168185 (Ance-like)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Antigen_Bd37
Motif
Other DBs
NCBI-GeneID: 100168185
NCBI-ProteinID: NP_001129384
APHIDBASE: ACYPI008911
UniProt: J9K7M4
LinkDB All DBs
Position
Un
AA seq 637 aa AA seqDB search
MTMKLYHLCVILCLLATVVWRPVLSAGIKNCSHCSEIEASKYLENANHALTQWTNRVIHA
NWNWLTNLTNENAEKKLAINLEFSKFLKCMWEETVKYPWTTYKNPNIKRQFKLMSVLGTD
ALPEDKLKKLEETIAAMESLYGRATIPEYGDNNSNRTLSLEPDINDILDKSTDVNELKHV
WVQWREATGKKVRPMYAEYVKLSNEAARLNNYTDTAEFWIRGYDVDDFRPRMERLWNQIK
PLYLQIHAYVRRKLRELYGDSMITKRGPIPAHLLGDMWAQSWERLDDFTRPYPTIDDVNP
TSAMINQNYTPKKMFKVAEEFFTSLNLSAMPQAFWEKSILEKPNGRDLVCHASAWDFYDS
NDFRIKQCTSVNFMDFITAHHEMGHVQYFLQYKDQPFIYREGANEGFHEAIGDTIALSVS
TPKHLHKIGLLPKTSRTYEADINYLYKIGLDKIAFLPFGYLMDLWRWNVFKGITTEDQYN
CDWWKLKYSYQGIEPPVTRTEKDFDPGSKYHIVGNVPYIRYFVSFIVQFQFHQALCEKAG
QFDPKNPSSQPLHECDIYQSTNAGNAFKDMLKLGSSKPWFDAMEQLTGQREMDAGPLLNY
FNPLYEWLKNENKRSGEYIGWETNKKICLKKGETSQP
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaaattatatcatttgtgtgtcatactatgtcttttggctacggtcgtttgg
cggccagtcctgtcggcaggaataaaaaactgctctcactgctctgaaatcgaagcttcc
aaatatttggaaaacgccaatcacgcattgacccagtggacaaaccgggtcatacatgcc
aattggaattggttaacaaacttgactaacgagaatgctgaaaaaaagcttgccattaac
ttggaatttagcaagttcttaaaatgtatgtgggaagaaactgttaaatatccatggaca
acatacaaaaatcctaatatcaaaagacagttcaaattaatgtcagtcttaggaacagat
gctttacccgaagacaaattgaaaaaattagaggaaaccattgcggccatggaaagtttg
tacggcagggccaccattccagaatatggtgacaacaattcaaatcgaactttgagtttg
gaaccagatataaatgacatattggataaaagtactgatgttaatgaactgaaacatgtg
tgggtacaatggagagaggccacgggaaaaaaagttcgacctatgtacgcggaatacgta
aaactgtccaacgaagcggccagattaaacaattacacggatactgcggaattttggatt
cgaggctacgacgtcgacgactttcggccgcgaatggaacgtttatggaatcagatcaaa
cctctatacttgcagatacacgcctacgtgcgtagaaagcttagggagctatacggtgac
tcgatgatcacgaaaagaggacctataccagcacatctgctcggtgatatgtgggcgcag
tcgtgggaacgtttggatgattttacccgaccatatccaaccatcgacgatgtaaacccc
acctcagccatgataaatcagaattacactccgaaaaaaatgtttaaagtggccgaagag
tttttcacatccttaaacttgagtgcaatgccccaagctttctgggaaaaatctattttg
gagaaaccaaatggtcgcgatctggtatgccatgcatcagcttgggacttttacgattct
aatgacttcagaatcaagcaatgcacatcggtcaattttatggattttataactgcccac
cacgagatgggacacgtccaatacttcctacaatacaaagaccagccgttcatataccgc
gaaggagctaacgaaggtttccatgaagcgatcggagatacaattgctttgtctgtatcc
acgccaaagcatttgcataagatcggtctcttgcctaagaccagccgcacgtacgaagct
gatataaattatctgtacaagatcggtttagataaaatagcgtttttacctttcggatat
ttaatggatctatggaggtggaacgtattcaaaggtatcacgacggaagatcaatacaat
tgcgactggtggaaacttaaatattcttaccaaggaatcgagccaccggtgaccagaact
gaaaaagattttgacccgggatccaaataccacatcgttggaaacgtgccttacattagg
tactttgtaagtttcatcgtacaatttcaatttcatcaagcattgtgcgagaaagctggc
cagtttgatccaaaaaatccatcaagccaaccgttacacgaatgtgacatttatcaaagc
acaaatgccggaaacgctttcaaagacatgttgaaattaggatcatcgaaaccgtggttt
gatgctatggaacaactaacggggcaaagagaaatggacgctggacctttgttgaactat
ttcaaccctctgtacgaatggcttaaaaatgaaaataaaaggtccggagaatatattggc
tgggaaacaaataaaaaaatttgcttaaagaagggtgaaacaagtcaaccttaa

DBGET integrated database retrieval system