KEGG   Acyrthosiphon pisum (pea aphid): 100169397Help
Entry
100169397         CDS       T01076                                 

Definition
(RefSeq) DNA repair protein complementing XP-G cells homolog isoform X1
  KO
K10846  DNA excision repair protein ERCC-5
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:api00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100169397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:api03400]
    100169397
DNA repair and recombination proteins [BR:api03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100169397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 100169397
NCBI-ProteinID: XP_001946726
APHIDBASE: ACYPI010020
UniProt: X1WJN7
LinkDB All DBs
Position
X
AA seq 951 aa AA seqDB search
MGVQGLWKLLESAGKPIPVEKLENKVLSIDVSIWMYQIIKGVQESDHGATTNRHLIVMFH
RICKLLFYGIKPIFVFDGGVPELKKITIAQRQAQKSRAKKSTGKTKEKLLKNMLEQAALK
TVMNAGNALTEDEVISKTVDSLNKGAEIDLFELPKLQEPVEIDKTKIPINEKDRSFLNLS
NEKNENILLLAVENQNNDFFYTNIAKDKEKSSPKKLNAFSSMQIGELLNGFSEDQKRLSQ
KKNQQKSKREMTFNELEMFLNNDSETIKNIDEFSQKIDSDHDTVFYYESGINKSAKSSNS
ENKEIPKKIKTSNFEKSVETESKSTSQKIFTTDTIGSPTLTDDIDEDIFKALAGDESLEE
DRLAWLIFNENKIASKRRSSEYESPNIKCPKPDTGFSSSSEVLTSDVEEDVTMKNNKVSS
KKYSSRSLFITEDNMSNEDVDSFNEEDYLSWVSHSKDEPSQTKLENKNPSINHHDIPSTS
KSSSFLGNEDNISNKKNNIEDQQIINESIYFVSKSIKTQEFNTLSNVSSSIESDNSNGSF
SENSVNFSPEESLSEDDNIILQENQNKQKVNKCSKKESDVPIVAKNEFKEINSTKNVIRE
KFNSPTKLNKISTKWPEPPDNQTNSMNEQYFQSIQDTLVKRQNDLASLQRKSDRMASSVT
QKITSEIKGLLKLFGIPYITAPMEAEAQCAFLEKIGRTEGTVTDDSDVWLFGANVVYKDF
FDNQKYVKQFKSIDIKQQFALSRNSFIQLAFLVGSDYTNGIDGIGPVSAIEILSFFESKT
KNMNIEEKLLKIKEIANSKAEVYCDIPFMKKLKSTKIGNDFPNKAVINAYLHPIVNESNE
SFNWGTLQVDSIIQFAQTNFDWDVSKTKSKLAPVLKKVAERTTQTTLDSFVKALPKLSST
NTGMSKRVSHAVKRLRNDSSSVESNKKTGISKKSLTDSNDSTDKKRRRHLK
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccaaggcttatggaaattattggaatctgctggaaaaccgattcccgttgaa
aagttggagaataaagtactgagtatcgatgtttcaatatggatgtaccaaataattaaa
ggtgttcaagaaagtgatcatggcgctacaacaaatagacatttaattgtgatgtttcat
agaatatgtaaattattgttctatggtattaaaccaatatttgtatttgatggcggtgta
ccagagcttaaaaaaataactatcgctcaaagacaagctcaaaaaagccgtgccaaaaaa
tcaactggaaaaaccaaagaaaaattattaaaaaacatgttagaacaggcagctttaaaa
actgttatgaatgctggaaatgcattgactgaagatgaagtgatttcaaaaactgttgac
agtttgaataaaggagcagaaattgatttgtttgagctaccaaaattgcaagaacctgtt
gaaatagacaagactaaaatacctataaatgaaaaagatcggtcattcttgaatttgtca
aatgaaaaaaatgaaaatattctactattagcagtagaaaatcaaaacaatgattttttc
tacacaaacatcgcgaaggacaaggaaaaaagttctcctaagaaattaaatgcattttct
tctatgcaaattggtgaactcttaaatgggttttcagaagatcaaaaacgtttatcacaa
aaaaaaaatcaacaaaaatcaaagcgtgaaatgacatttaatgaattagaaatgtttttg
aacaatgacagtgaaactattaaaaatattgacgaattcagtcaaaaaattgattctgat
catgatactgttttttattacgagtctggtatcaacaaatcagccaaaagtagtaattca
gagaataaagaaattcctaaaaagataaaaacttcaaattttgaaaaaagtgttgaaact
gaatcgaagagcactagccaaaagatttttactactgataccattggatcacctacatta
acagacgacattgatgaagatatatttaaagcacttgctggtgatgaatccctcgaagaa
gatagattagcttggcttatcttcaatgagaataaaatagctagtaaaagacgatcaagt
gaatatgagtcaccaaatataaaatgtcctaaacctgatacaggttttagtagcagttcc
gaagtattaacatcagacgtggaagaagatgtaactatgaaaaataacaaagtatcgtcc
aaaaaatattcttccagaagtctttttattactgaagataatatgtctaatgaagatgta
gatagttttaatgaagaagattatctgtcatgggtgtcgcatagtaaagatgaacctagc
cagacaaaattggaaaacaagaatccaagtattaatcatcatgatattccatctacaagc
aaatcttcatcatttctaggaaatgaagataatatatctaataaaaaaaataatattgag
gatcagcaaattatcaatgagtcaatatattttgtatcaaaatctataaaaacacaagaa
tttaacacattgagtaatgtttcatcctcaatagaatctgataattcaaacggctctttt
tctgaaaattctgtcaatttttcacctgaggaaagtttatctgaagatgataatataata
ttacaagagaatcaaaacaaacaaaaagtcaataaatgttctaaaaaagagtcagatgtt
ccaatagttgctaaaaatgaattcaaagaaataaattcaacaaaaaatgtaataagagaa
aaatttaattctccaacaaaattaaataaaatatctacgaaatggcccgaacctcctgac
aatcaaacaaattctatgaatgaacaatattttcagtccatacaagatacattagttaag
cgtcaaaatgatttggctagtttacaaagaaaatctgatcgaatggcttcttctgtaaca
caaaaaattacttcagaaataaagggtctcttgaagttgtttggcataccatatataaca
gcaccaatggaagcagaagcacaatgtgcttttttagaaaaaatcggaagaacagaaggt
actgtgacagatgacagtgatgtgtggttgttcggagctaatgttgtttataaagatttt
tttgacaaccaaaaatatgtaaaacaattcaaaagcatcgatattaaacaacaatttgct
ttgtctcgaaatagttttattcaattagcatttcttgtgggaagtgattacacaaatggt
attgatggtattggtccagtatctgctattgaaattttatctttttttgaatctaagact
aaaaatatgaacattgaagaaaaattactaaaaattaaggagatcgctaactcaaaagct
gaagtatattgtgatataccatttatgaaaaaattaaaatcgaccaaaattggcaatgat
tttccgaataaagctgttattaatgcatatctccacccaattgtaaatgaatcaaatgaa
agctttaattggggtacactccaagtggactcaatcattcaatttgctcaaactaatttt
gattgggatgtttctaaaacaaaaagcaaattagcgccagtgttaaaaaaagttgctgaa
cggacaacccaaacaacattggattcatttgtcaaagctcttcctaagttgagcagtaca
aatactggtatgagtaaacgtgtcagtcatgctgtaaaaaggttacgaaatgatagcagt
tcggtcgaatctaataaaaaaactggtatttcaaaaaaatcattaactgattcaaatgat
agtacggataaaaaacgtaggagacacctaaaataa

DBGET integrated database retrieval system