KEGG   Acyrthosiphon pisum (pea aphid): 100571907Help
Entry
100571907         CDS       T01076                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2D
  KO
K09188  histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100571907
Enzymes [BR:api01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100571907
Transcription factors [BR:api03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100571907
Chromosome and associated proteins [BR:api03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100571907
   HMT complexes
    MLL3/MLL4 complex
     100571907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC FYRN SET zf-HC5HC2H_2 zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 100571907
NCBI-ProteinID: XP_003245446
UniProt: X1X126
LinkDB All DBs
Position
Un
AA seq 2285 aa AA seqDB search
PSVNTSNTYQGAKVTNVTISQGSQIQQPQQIQRLTFQQLTPQQQQLLLQRKLTQKAILIS
QQQQELNNSANQDPLAVQQRQMQLAQHRQMLLQQIDQIQKQMNDGQNQQQRQILVQQAVP
GNQDSKSELSPQQRQQIVIQRQNIILQQQQQFQQLQQQNVPQQQQILQPQNNQNQMQLQS
QNNQNTIQVQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQNPGQT
NMTQQQKLFQHQQLQLQIAKQQHILAQHNAQIQQKLVQRSPQQQNVIQSQLSPQQQQTVL
LQQTIKQEPGEIVNPNIIRQQQQQQQQQQQILLQRQQQTRFLQQQLISQGKVTRQMVQSQ
QQSPIPPQSPNQPPLSPMPPQSPISNNQQYCQPNSPMISTQSPMLSQSPQQFSQPVQSPN
PVQFTPNSPMPSQSPRQTQFVQPTSPLMPQSPMVQGYTHPPATSPFGQPPSSPSPRPSQS
PRNSLGPPSSPMSPMQQNPYIRPTTSPMPARRPNVGSSPLMPDQQENREENNVPPEGYQY
AKLGLRGGGHYCLPPKGFKYTKLGLKGGAPMWSTGRQFVSKDAQDEVKRSVFKSNDMPLS
AIPVSKVSSLVSLEYGDSDDEGSRTPPVPSPQPPPIQISKQKEAPEGINTDPMIISTSPK
NEDSQNLPVYKDVNLLENCKKNSIEELDDIQMISTIHNMNIDPGQISLNSSRVGEELLDM
DREINSPGLMLNENDDSILGGLPKDEASEMDRLMFFDELGDSIKCDQEEKSGSPEKSVFN
LDKLLNDPEPHIEQKEEFKAEVIQQENNLAELSQENEEANIDNVIQSYSFHSYAKVPRPA
PSPKKENRLVSILKTDQSDDLKKVTSLFRSHPSTQSKNIIILNPSSDTLKDQQVKQNLLL
TKADNLIHSDLAQILSNIMSPKQKDSFIKIDTSKSDEHTKHSTIVLPARTTSVVQNSQKI
HWDSIATFTTASSTSYAKSIQIISKPEDKELKNSSQLSCMINVPKPESRTPKVVEESQNV
LLKQLLQNTACANQTPTTTTAISLPIIPSLEAQLARPVSPTPSLLFPSLLSPKKDDKFES
QHQLLKPLKLDIEPMAQRPESQPQVLQKPEPQIPIQKSEPQAQILKLEPQSSPKPVVILQ
RSDIQTPVTQNSPTPPPPPPPPLLQPSLLQVQPESQLQPQSTRPIASTDSIMESINSAIK
QERLEEEIKNEVHLPVTTLTGFSPEREVKREIMSSDELVSPQNSTRIVDPADMNNSMNVS
IDMNADTQDQKKYKRRQYYAKRRQSQGKDVSSTIIPKKRHRKGSKPEEDYDSFIDALMSQ
LRQLQPMSVIEPSLNQNLTACPLFGIGDVLSQQNFKSGDLKGKVGSCNLPGESDYYNTKP
FGDLEPVSPLPQPSTQRGFYNEEFDPLKFESDNDEKKFDIGRDRDDTPDTVMSSSSPELA
VCQTPTHFPGLKNYDDDSDSTDTLLNFTRYMSPVHQLVAPLALKPRPNYKINIEDDKENQ
GARQGMLSQVGKTPPRSSPALPLRDSNTMTVTLTITSDAAEDIMGVLQGLANLLDLPDIP
NYKVTERTVTPMSHKLGLYRSKTKDGKEGAPIDIQTILNGFAKFCRHCDLVILNNLIKKK
ASEIPFLTVEECADEIFFCSTMCFQTFASLLRPPAESKDKATTNVNHLSEGSPPKRLKVE
PETSPISNKTDYTEKMDIDDTSKNIEESKPEPTVEETKTLNKGTIYRLWNTNSVPAPLTK
HKKSTDKDLMEMLFRMGITVTSPKLPEDKRLCLFCHQYGDGVSDGPSRLLNFDVDKWVHL
NCALWSEDVYETVNGALMKVDIALRQSLSVECIVCQRPGATLKCYKLRCSTNYHLPCAVK
DDAVFYKNKTLYCSGHAPKSDKENELTTLSVHRRVYINRDENRQVAAVMHHSSSHQFLLR
VGSLTLLNIGQLLPHQLAAFHTPTSIYPIGFKVVRLFWSMRVPNKRCKYICSIHEVNARP
EFRIIVQEVDNEDLELKDSSPRAVWSKVLSAIASMRTTNNLLKLHPQHVSGDSLFGLTEP
AIVRVLESLPGIETQSDYRFRYGRNPLLELPLAINPSGCARCEGRRRLVLPGKLRSHIPR
SFTSSHGSSLLSQLDLSAPPTCPYSKHFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLY
AARDLEKHTMVIEYIGEIIRSQLCDYREKLYEAKNRGIYMFRLDDDRVVDATISGGLARY
INHSCNPNCVTEKVEVDRELRIIIFAKRRIARGEELAYDYQFDIEDDQHKIPCNCGAPNC
RKWMN
NT seq 6858 nt NT seq  +upstreamnt  +downstreamnt
ccatctgtgaatacttcaaacacatatcagggcgcaaaggtgacaaatgtcacaataagc
caaggatcccaaattcaacaacctcagcagatacaacgactaacattccaacaattaact
cctcaacagcaacagttgcttttacagaggaagctcacccaaaaagccatacttatatct
cagcaacaacaagaattaaacaattccgccaatcaagacccattagcagtccaacaacga
caaatgcaattagctcaacatagacaaatgttattacagcaaattgatcaaattcaaaaa
caaatgaacgatggacagaatcagcaacaaagacaaatactcgttcagcaagcagtacct
ggaaatcaagatagtaaatcagaattgtctcctcaacaaaggcagcagatagttattcag
agacaaaacataatattacaacagcaacaacagttccaacagttacagcaacaaaatgtt
ccacaacaacaacaaattttgcaaccacagaataatcagaatcaaatgcaattacaatct
caaaacaatcaaaatacaatacaagtacaacagcagcagcagcagcagcaacagcaacag
caacaacagcaacaacagcaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacagcagcagcagcagcaacagcagcagcagcaacaacaacaaaatcctggacagacc
aatatgactcaacagcaaaaattatttcaacatcaacaactacagctacagatagccaag
cagcagcatatcctggcacaacacaatgctcaaattcaacaaaaattagttcaacgttcg
ccccagcaacaaaatgtaattcagtctcaactatctcctcagcagcaacaaacagtactg
ttacagcagactattaaacaagaaccaggagaaattgttaatccaaatattattcgtcaa
caacagcaacaacagcaacagcaacagcaaattttattacagcgccagcaacaaacaaga
tttttacaacaacaacttatatctcaaggcaaagtcactagacaaatggttcagtcccaa
cagcagtctccaattcctcctcaaagcccaaatcagccacctttatctccaatgcctcca
caaagtcccatatccaacaatcagcaatactgtcaaccaaatagtccaatgatatcaact
cagtctccaatgctgtcacagagtcctcaacaattttcacaaccagtacaatcgccaaac
cctgtacagtttactcctaattcaccgatgccttctcaaagccctaggcaaactcagttt
gtacaaccaacatcgccattaatgcctcaaagtcctatggtccagggatatactcatcca
ccagcaacttcaccatttggacaacctccaagctcgccaagtcccagaccatcgcagagt
ccaagaaatagtctgggcccccctagttctccaatgagtcctatgcaacaaaacccatac
atcagacctacaacgagtcctatgcccgctagacgaccaaatgttggtagtagtccattg
atgccagatcaacaagaaaacagggaagaaaataatgtaccaccagaaggatatcagtat
gctaaattaggacttcgtggaggcggacattattgcttacctcccaaggggtttaagtac
actaaattaggtcttaagggtggagcacctatgtggagtactgggaggcagtttgttagt
aaagatgctcaagatgaggtaaaaagaagcgtattcaaaagtaatgatatgccattaagt
gcaataccagtatcaaaagtttcatcattagtatcgttagagtatggagattcggatgat
gagggttcaagaacacctccggtaccttcccctcaaccacctccaattcaaatatccaaa
caaaaagaagctcctgaaggaattaacacagatccaatgattatttcaacttctcctaaa
aatgaagatagtcaaaatttaccagtttacaaagatgtaaatttattggaaaattgcaaa
aaaaatagcattgaagaattagatgatatacaaatgatatcaactatacacaatatgaac
atagatcccggtcagatatcattaaactctagtagagttggcgaagaattattggatatg
gatagagaaattaattcacctggtctgatgttgaatgaaaatgatgatagtattcttggt
ggtcttccaaaagacgaagcttctgaaatggatagactgatgttttttgatgaacttggc
gatagcataaaatgtgatcaggaggaaaagagtggatcaccagagaaatctgttttcaat
ctggacaaattactaaatgatccagaaccacatatagaacaaaaagaagagtttaaagct
gaggttattcaacaagaaaacaatttagcagaattaagccaagaaaatgaagaagcaaat
attgataatgttatccaaagctattcatttcattcttatgcaaaagttccaagaccagcg
ccatcgcccaaaaaagaaaaccgtttggtgtctattttgaaaaccgatcaatcagatgat
ctaaaaaaagtgactagtctatttcgatctcatccgtctacccaaagtaaaaatattatt
attttaaacccttcatcagatacattaaaagatcaacaagttaaacaaaatttactatta
acaaaggcagacaaccttatacattcagatttagctcaaatcttaagtaatattatgtct
cccaaacagaaagatagtttcattaaaattgacacatcaaaatcagatgagcacacaaaa
cactcaaccatagttttaccagcccgtacaacatcagttgtgcagaattctcaaaaaatt
cattgggattcaatagcgacatttactactgcgtcttcaacttcatatgctaaatcaatt
caaataatatcaaaacctgaagacaaagaactaaaaaacagctctcagttatcatgtatg
ataaatgtacccaagccagaatcacgtacacctaaggttgttgaggaatctcagaatgta
ttgcttaagcaacttcttcaaaacactgcatgtgctaatcaaactccaactactacaact
gctataagtttgccaattataccttctctcgaagctcagcttgcaaggcctgtttcacca
acaccatctttattatttccttcattactttcaccaaaaaaagatgataaatttgaatct
caacatcaattactgaaacctttaaaactagatattgaacctatggcacaaagaccagag
tctcaacctcaggtgcttcaaaagcctgaacctcaaataccgatacaaaaatctgaacca
caagctcaaattctaaaacttgagccacagtcttctcctaaacctgtagttattctacag
cgttctgatattcaaacacctgttacacaaaattcacctacaccaccaccaccaccacca
ccaccacttcttcaaccatctttactgcaagtacaaccagaatcacagctacaaccacaa
tcaactcgaccaatagcttcaacagattcaataatggagtctattaactcagcaattaaa
caagagcgtttagaagaagaaattaaaaatgaagtacatttacctgtaactacattgact
ggatttagccctgaaagagaagtaaaaagagaaattatgtcatccgatgaattagtatca
cctcaaaattctactagaatagtagatccagcagatatgaataattcaatgaatgtgtca
atagacatgaatgcagatactcaagatcaaaaaaaatacaaacgtaggcagtattatgct
aaacgtaggcaaagtcaagggaaagatgtaagttctacaatcatcccaaaaaaacgacat
cgaaaaggttctaagccagaagaagattatgattcttttattgatgcacttatgtcacaa
ttacgacagcttcagccaatgagtgttattgagccatctttaaaccaaaacttaacagct
tgtccattgtttggcataggagatgtattatctcagcaaaactttaaaagtggtgattta
aaaggtaaagtgggttcatgtaatctgccaggtgagagtgattattacaatacaaaacct
tttggtgatttggaacctgtctcaccattacctcaaccttccactcaaagaggcttttac
aatgaagaatttgaccctttaaagtttgaatctgataatgatgaaaagaagtttgatatc
ggacgtgaccgcgatgataccccagacactgtgatgagctcttcttcaccagaattggca
gtatgtcaaactccaacccattttccagggcttaaaaattatgatgatgatagcgattca
acagatacactgttaaattttactcgatacatgtctccagttcatcaacttgttgcacca
ctagctttgaaacctcgtcccaactataaaatcaatatagaagatgataaagaaaatcaa
ggtgcaagacaaggaatgttgtctcaagttggtaaaacacctccacgaagttcacctgca
ttaccattacgggattccaatacaatgacagttacattaactataacttcagatgcggct
gaagatattatgggagttcttcaaggcttagctaatttactcgatttacccgatattcct
aattataaagttactgaaagaactgttacaccaatgtctcataaattaggactgtacaga
tctaaaaccaaagatggaaaagaaggagctccaatagatattcaaactatattaaatggc
tttgccaaattttgtcgtcattgtgatttagtgatattaaataatttaataaaaaagaaa
gcaagcgaaattcccttcttaactgtcgaagagtgtgcagatgaaatatttttctgtagt
acgatgtgctttcaaacttttgcttcgcttttacgcccaccagctgaatctaaagacaaa
gcaacaaccaatgttaatcatttatctgaaggttcaccaccaaagcgtttaaaagtagaa
cctgaaactagtccaatatccaataaaactgattatactgaaaaaatggatattgatgac
acttcaaaaaacattgaagaatcaaaaccagaaccaactgttgaagaaacaaaaactttg
aataagggtactatttacagactttggaatacaaatagtgttccagctccactaactaag
cataaaaaatctactgataaagatctaatggagatgttgtttcgtatgggaattactgtt
acatcacctaaattaccagaagacaaacgtttgtgtttattttgtcatcagtatggagat
ggtgtttcagatggaccctctaggttattaaactttgatgttgataaatgggtacattta
aactgtgcattgtggtcagaagatgtttatgaaactgttaatggagctttgatgaaagtt
gacattgctttacggcaatctctcagtgtggaatgtatagtatgtcagcggcccggtgct
acacttaaatgttacaagcttagatgttccacaaattatcatttaccatgtgctgtcaaa
gatgacgctgtgttctataaaaataagactttgtactgcagtggtcatgctccaaagagt
gacaaggaaaacgaactgaccacgttgtctgtacatcgacgtgtttacattaatagagat
gagaatcggcaagttgctgctgtaatgcatcattcaagttctcatcagtttttgttgcgt
gttggtagcctaacacttcttaatattgggcaattattgcctcatcaattggctgcattt
catactccaacttctatttatccaattggtttcaaagtggtccgtttgttttggagtatg
cgagtacctaacaagcgttgtaaatatatatgttctattcatgaagtaaatgcacggcct
gagtttagaattattgtacaagaagtggataatgaagatctagagctaaaagattctagt
ccaagagcagtttggtcaaaagttttgtcggctattgctagtatgagaactacaaataat
ttgttaaagctacacccacaacatgtgagcggcgacagtttatttggacttactgaacca
gcaattgttcgtgtcttagagagtttgcctggaattgagactcaatctgattaccgtttc
cgttatggtcgtaatcctcttctagaacttcctttagctatcaacccaagtggatgtgct
cgttgtgagggccgtagacgactagttcttcctgggaagttacgatcacacattcctaga
tcatttacatcatctcatggttcatcattattgagtcaactagacttatcagctccccct
acttgtccgtattctaaacattttgttcattcaaaatcctcgcaatataaaaaaatgaaa
caagaatggagaaacaatgtgtacttagccaggtctaaaatccaaggtttgggactgtac
gctgctagagatttagaaaaacatactatggttattgaatacattggtgaaattatccga
tcacagttgtgtgattatagagagaaactttacgaagctaagaatcgcggtatatacatg
ttccgtctggatgacgatcgagtggttgatgctactataagtggaggtctagctcgttat
attaatcactcatgtaatcctaactgtgttactgaaaaagtggaagtagaccgagagctt
cgaattataatatttgccaagcgaaggattgccagaggcgaagagcttgcgtatgactac
cagtttgacattgaagatgatcaacacaagattccgtgcaactgcggtgctcccaactgc
cgcaaatggatgaactga

DBGET integrated database retrieval system