KEGG   Acyrthosiphon pisum (pea aphid): 115033632Help
Entry
115033632         CDS       T01076                                 

Definition
(RefSeq) fatty acid synthase-like
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00061  Fatty acid biosynthesis
api01100  Metabolic pathways
api01212  Fatty acid metabolism
Module
api_M00082  Fatty acid biosynthesis, initiation
api_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    115033632
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:api01004]
    115033632
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:api04147]
    115033632
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     115033632
Lipid biosynthesis proteins [BR:api01004]
 Fatty acid synthase
  Animal type
   115033632
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   115033632
  Exosomal proteins of breast milk
   115033632
  Exosomal proteins of colorectal cancer cells
   115033632
  Exosomal proteins of bladder cancer cells
   115033632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc
Motif
Other DBs
NCBI-GeneID: 115033632
NCBI-ProteinID: XP_029342373
LinkDB All DBs
Position
A1
AA seq 416 aa AA seqDB search
MTEHKDEVVISGIGGLFPESNNINELSDLLFQKKNGVTIDSRRWKPNKLGALSGTGKIKN
IDTFDSAFFRVHPKLAKVMDTMTKISLERSIEAIIDAGLSPADLYGTNTGVFMGSAISET
EMKAMDTDSSLGFVMLGTSRAMQANRLSFILNLTGPSFSMDGGWICGSNGLKKAKEMIEN
GLLPSAIVGVTNLTLRPDLQFLYQGLNRLNKSNQTKPFSSDADGYNRSEACIVLYLQKAS
EAKRSYGTLLNVKSMQFGNHDGTLTEHDGNHFKSLLLDSYKEADIDPATVDFIEAYGSGI
KSEDAMELNIMEEVFCTENRRTPLKVGSVKSNVGHCEVSSLFMSIVKAIITLESGYIPPN
INYTGPNNNVAALKNGKIQVITEKTPFVGDIIGISSFGLLNAFSHVIIRKIRSLIT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacacaaagatgaagttgtaatatcaggtatcggtggattgtttccagaaagc
aataatataaatgaattgagcgatttgttattccaaaaaaaaaatggagtaactattgat
tcaaggagatggaaaccaaataaactaggtgcattaagtggaactggaaaaattaaaaat
atcgatacatttgattccgcattcttcagggttcatccaaaacttgctaaagttatggac
acaatgacaaaaataagcttagaaagatcaatcgaagcaattattgatgccggtttgagt
ccagcagacttgtatggaacaaatacaggagtatttatgggatcggcaataagtgaaacg
gaaatgaaagccatggataccgattcatctctaggatttgtaatgttaggaactagtaga
gcaatgcaagcaaaccgactttcttttattcttaatttgacaggacctagtttttccatg
gacggaggatggatttgtggctccaacggtttaaaaaaagccaaagaaatgattgaaaat
ggtttattaccatctgcgattgtcggtgttactaatttgacccttcgaccagatttacaa
ttcctatatcaaggattgaatagattaaacaaaagtaatcaaactaaaccattcagttct
gacgctgatgggtataacagatcagaagcttgtattgttttgtatcttcaaaaagcttct
gaagccaaacgttcatacggaacattgttgaatgtaaaatcaatgcagtttggtaatcat
gatgggaccctaaccgaacatgatggaaatcactttaaatcattgctattagattcttat
aaagaagctgacatagatccggctacagtagatttcatagaagcttacggatcgggaatt
aagagtgaagatgctatggaattaaatatcatggaagaagtgttttgtactgaaaataga
aggacacctttaaaagtgggttccgtgaaaagtaacgtaggtcactgtgaagtgtctagt
ctctttatgtcaattgttaaagccatcattacgctagaaagtggatacataccacctaac
ataaattacacaggaccaaataataatgtagcagcgttaaagaatggaaaaattcaagta
ataactgaaaaaactccttttgttggagatataatcggaatcagttcatttgggttatta
aatgcatttagccatgtaatcataagaaaaatcagatcgttaataacataa

DBGET integrated database retrieval system