KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0004Help
Entry
APJL_0004         CDS       T00644                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Brite
Enzymes [BR:apj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     APJL_0004 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu PepSY_2
Motif
Other DBs
NCBI-ProteinID: ABY68610
UniProt: B0BRG2
LinkDB All DBs
Structure
PDB: 

Position
complement(3804..4376)
Genome map
AA seq 190 aa AA seqDB search
MKLTNLALAFTLFGASAVAFAHADHDHKKADNSAVEKLVVQVQQLDPVKGNKDVGTVEIT
ESAYGLVFTPHLHGLAQGLHGFHIHQNPSCEPKEKDGKLVAGLGAGGHWDPKETKQHGYP
WSDNAHLGDLPALFVEHDGSATNPVLAPRLKKLDEVKGHSLMIHEGGDNHSDHPAPLGGG
GPRMACGVIK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacaaatctagctctcgcttttacattattcggcgcatcggcagttgccttt
gcacatgcggatcatgatcataaaaaagcggataacagcgcagtggaaaaacttgtcgta
caagtacaacaacttgatcctgtaaaaggaaacaaggatgtcggtacggtagaaattacc
gaatctgcatacggtttagtgtttactccgcacttacacggtttagctcaaggtttacac
ggcttccatattcaccaaaacccaagctgtgagccgaaagaaaaagacggtaaactggtt
gccggtttaggcgctggcggtcactgggatccgaaagagaccaaacaacacggttatccg
tggtctgataacgcacacttaggcgatttaccggcattattcgtagagcatgacggttct
gcaactaaccctgttcttgcgccacgtttgaaaaaactggatgaagttaaaggtcattct
ttaatgattcacgaaggtggcgataaccactctgatcacccggctccattaggcggtggc
ggtccgcgtatggcttgcggcgtcatcaaataa

DBGET integrated database retrieval system